KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1833Help
Entry
ASA_1833          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABO89909
UniProt: A4SLY7
Position
1921352..1921846
Genome map
AA seq 164 aa AA seqDB search
MFVFDVTGVAGERAEIRVQALDWGQTGPVTFSCDDDKLAVLLLTDCRCDAVGFFNLLAGS
KPLYVEQWLSYLQETGRIARQSSQLESPAQTDYLARAGFEHEELNALLGQIYQVAGFNRL
QINRYLKNRHNPTTLATRYDQKELERYRQLNDIILTLLKLKRPQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtatttgacgtaaccggcgttgcaggggagcgtgccgagatccgggtccaggcg
ctggactgggggcagacaggccctgtcaccttcagctgtgatgacgataaactggcggtg
ctgctgctcaccgactgtcgctgtgatgcggtcggcttcttcaatctgctggccggcagc
aagcccctctatgtggaacagtggctctcttatttgcaggagactggccgtatcgccagg
cagagcagccagctggagagtcccgcccagaccgattacctcgccagagccggctttgaa
catgaagagctcaatgcgctgcttggtcaaatctatcaggtggcgggtttcaatcgcctg
cagatcaaccgttacctcaagaatcgccacaatcccaccacgctggcgacccgttacgat
cagaaagagctggagcgctatcgccagctcaacgacatcattctgactctgctgaagttg
aaacgtcctcagtaa

DBGET integrated database retrieval system