KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1837Help
Entry
ASA_1837          CDS       T00500                                 

Definition
(GenBank) lipoprotein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1439
Motif
Other DBs
NCBI-ProteinID: ABO89913
UniProt: A4SLZ1
Position
complement(1927158..1927709)
Genome map
AA seq 183 aa AA seqDB search
MLKHLLLLPLSLLLAACSLTQYNVSESEINQYLKERVAFEKQLGIPGIMSSKVRLDEMQS
RIGRSSADRIELDAAGDLQVSSPLGSQQMKIRFSLSARPDYVAEQGAIYLRDLELVSVKT
EPADVGAALTPLLSTFNQSLSLFFSQTPVYRLDGSRKNEARIKDKIEALKVEPGRLVIPF
KLL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcacctgcttctgcttcccctcagcctgctgctggcagcctgttcgctcacc
cagtacaacgtcagcgaaagcgaaatcaaccaatacctcaaagagagggtcgccttcgag
aaacagctggggatccccggcatcatgtcgagcaaggttcgtctcgacgagatgcagagc
cgcatcggccgcagcagcgccgatcggatcgagctggatgctgccggtgatctgcaggtc
agcagcccccttggcagccagcagatgaagatccgcttctccctcagcgcccgccccgac
tatgtggccgaacagggtgccatctatctgcgcgatctggagctcgtctcggtcaagacg
gagccagccgacgtgggcgccgccctcactcccctgctctccaccttcaaccagtccctc
tccctgttcttctcccagacccccgtctaccgtctggatggcagtcgcaaaaacgaagcc
aggatcaaagacaagatagaggctctcaaggtagaaccgggtcgactggtcatccccttc
aagctgctgtga

DBGET integrated database retrieval system