KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1838Help
Entry
ASA_1838          CDS       T00500                                 

Gene name
entC
Definition
(GenBank) isochorismate synthase
  KO
K02361  isochorismate synthase [EC:5.4.4.2]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00130  Ubiquinone and other terpenoid-quinone biosynthesis
asa01053  Biosynthesis of siderophore group nonribosomal peptides
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01130  Biosynthesis of antibiotics
Module
asa_M00116  Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ASA_1838 (entC)
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    ASA_1838 (entC)
Enzymes [BR:asa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     ASA_1838 (entC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-ProteinID: ABO89914
UniProt: A4SLZ2
Position
1928109..1929317
Genome map
AA seq 402 aa AA seqDB search
MENSAPAQAAMENSAPAQAASPPDFLFTSGQGTISAYDLGQPITTPACEWPLLERQIARA
LAAAEAAGQANPLLVGAFAFDPAEASCLYVPGRYERGVRMASEPMTFAAKAALASAPASN
QVISVQSTPAAAEFKASVSSALDAFAQGRLSKVVLSRKLSLTLHKPADPEQVLARLMSQN
PHAFHFSLPLGQDRRLLGASPELLLRVSGGEVFTHPLAGSAKRGNEPEQDKRVARDLLAS
RKDQHEHRLVIDEIRRVLTPHCRELAIPANPTLMSTDTLWHLGTPIAGQLNPGQASVLSL
ACQLHPTPALCGYPTELARQFIREQEPFRRALFSGIVGWCDSQGNGEWAVVIRCGVLDGH
QVELFAGAGIVAGSDPAMEWAETGTKLGTMLNALGLDLEVAQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatagcgcgcctgcccaggctgcgatggaaaatagcgcgcctgcccaggctgcg
tccccgcccgatttcttgtttacctcaggtcagggcacgatcagtgcctacgacctgggc
cagcctatcaccacgcccgcctgtgaatggcccttgctggagcgacagatagcccgggcg
ctggcggcggccgaggccgcagggcaagccaatccgctgctggtcggtgcctttgccttc
gatccggccgaagcctcttgcctctatgtgcctggccgctatgagcggggcgtgcgcatg
gcctccgagccgatgacgtttgcagccaaagccgcccttgccagtgcacctgcgagcaac
caggtcatttcggtacagagcacaccggcggcggccgagttcaaagcttcggtcagctcg
gcgctggatgcgtttgcacaaggtcgtctctccaaggtggtgctgtcgcgcaagctatcg
ctcactctgcacaagccagccgatcccgagcaggtgctggcccggctgatgagccagaac
ccccatgccttccacttctccctgccgctcgggcaagatcgccgcctgcttggggccagc
cccgagctgctgctgcgggtcagcgggggagaggtgttcactcacccgctggcgggctct
gccaagcgcggtaacgagccagaacaggacaaacgggtggcccgggatctgctggcctcc
cgcaaggatcagcatgaacaccgcctggtgatcgacgagatccgccgggtgctgacaccg
cactgccgtgagctggccattcccgccaatcctaccctgatgagcacggataccctctgg
catctgggcacgcccatcgccggccagctgaatccgggtcaggcttctgtgctctccctg
gcttgccagctgcatccgaccccagccctgtgcggttatcccaccgagctggcgcgccag
ttcatccgcgagcaggaacccttccggcgtgccctgttcagcggcatcgtcggctggtgc
gacagtcagggcaatggcgagtgggccgtggtgatccgctgcggtgtgctcgatggccat
caggtggagctgtttgccggcgccggcatagtggcaggctcggatcccgccatggagtgg
gccgagaccggcaccaagctgggcaccatgctcaacgcgcttggtctggatctggaggtg
gcacaatga

DBGET integrated database retrieval system