KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1841Help
Entry
ASA_1841          CDS       T00500                                 

Gene name
entF
Definition
(GenBank) ferric siderophore synthetase component F
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABO89917
UniProt: A4SLZ5
Position
1931914..1935003
Genome map
AA seq 1029 aa AA seqDB search
MSRFPLTIPQQGLWSGHLLNDDKAMFNTAECIAFDGKVDVAVLVAALTRAVGECEALKGH
FEDDGEAVCFVSDEAPLAYGEVNLESDDEVVARAWAWADLRRPFKLTEEAPCRLALLRGP
GRDYLYSCVHHIALDGFGTTLLFQRIAELYGEGLAGAVPSPSPFGLLDEVLAEELAREES
GKNAAARSFWQEQLQAWPEVKSFGETRAPIAAEFIRESRPLPAALWQSLTGFADEHKLGW
PELLLAGLSAQLSLASGQQQTLLGLMMMNRIGSASLTVPCMQMNITPLALALGEELDLAG
AAGAVAKAKRGVRKHQHYRYELLRRDLGLVGGDKRLFGPLVNIMPFDHARRFGPLSAHIL
NISAGPVEDLTIEVQVGADGQPRLDLDANPGCYQQQDLATIADTLFALLGRWLAQPAQNL
GSLKADWLAEQRQGAMITAPAHEVIKVRPVLDALCHFAAQTPNKIALIQGEASVSYEALL
ARCEQMAAALQASGVQPGDRVGVMLARSPLAIFTQLAVLLAGAVYVPLDPEQPLERQGHI
LRLGEVKTLITQAEYRHKLASLFEGRTLLAGDLVSDNRLNQPAAGRAVAYLMFTSGSTGL
PKGVAVSHGALDHFAAAARCRYHLNEGARMLQFAPFNFDASIEEVFATLSAGATLVLRTD
ALLESMAAFAAGVEQMGITHLDLPTAFWNEWVVALTAGQAHIPASLATVIIGGEAVYPEQ
LAQWQRQGRSDVRLFNTYGPTETTVVVTTQELQQEDPNQAQLPIGLPLPGMQALILGAGE
QPASEGEMVLLGPQLANGYVGGVQGSFETLRVGEQALPVYRTGDRVRLAAGRLVYLGRRD
NEFKISGYRIQPGEVEAQLLALPGVDEACVQGVSIGSVRRLVAFVAGSERDSRAIKAQLA
KMLPAAMIPTDYRHYDQLPRTGSNKLDRKALLAQYQSTDEALTLGSETENRVGAIWQQIL
GLATMAPADNFFELGGQSLQTIQIVNRLGAEFGVQVKVSDVFDHPRLDDFCRFLDGKLTE
DEESVEMVW
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcttccctctgactataccccaacaggggctctggtccggtcatttgctcaac
gacgacaaggccatgttcaacaccgccgagtgcatcgcctttgatggcaaggtcgacgtg
gccgtgctggtggccgcgctcacccgggctgtgggtgagtgcgaggcgctcaagggccac
ttcgaagacgatggggaggcggtctgcttcgtctcggacgaggcgccactcgcctatggc
gaggtgaaccttgaaagcgatgacgaggtcgtcgcccgcgcctgggcatgggccgatctg
cgccgcccgttcaaactgaccgaagaggccccctgccgcttagccctgctgcgtggcccc
ggtcgggattacctctacagttgcgtgcaccacatagcgctggacggttttggcaccacc
ttgctgttccagcgtatcgccgaactctatggcgaagggctggcaggggctgtgccgtcg
ccatcgccgtttggcctgctggatgaggtgctggccgaagagctggcccgtgaggagagc
ggcaagaacgccgccgcccgcagcttctggcaggagcaattgcaggcctggcccgaggtg
aagtcctttggcgagacccgcgcgcccatcgccgccgaatttatccgcgagagccgtccg
ctgcccgcggcgctgtggcaatccctgaccggctttgccgacgagcacaagctgggttgg
cctgagctgctgctggccggcctatcggcccagctctcccttgccagtggccagcaacaa
acgttgcttggcctgatgatgatgaaccgcatcggctcggcctccctgaccgtgccctgt
atgcagatgaacatcaccccgttggcgctggcgctcggtgaagaactggatctggcgggg
gcggccggcgccgtggccaaggccaagcgcggcgtgcgcaagcaccagcactaccgctac
gaactgctgcgccgcgaccttggcctggtggggggcgacaagcgattgttcggccccttg
gtcaacatcatgccgttcgatcacgcccgccgtttcgggccgctcagtgcccatatcctc
aacatcagcgccggcccggtggaggatctcaccattgaggtgcaggtcggcgccgatggc
cagcccagactggatctggacgccaaccccggctgttaccagcagcaagatctggcgacc
atcgccgataccctgttcgccctgctgggccgctggctggcccagcccgcccagaacctg
ggcagcctcaaggccgactggctggccgagcagcggcagggagccatgatcacggctccc
gctcacgaagtgatcaaggtgcggccggtgctggacgcgctctgccacttcgccgcccag
accccgaacaagattgccctgatacaaggggaggcgagcgtcagctacgaggcactgctg
gcccgctgcgagcagatggcagcggccctgcaggcgtccggcgtgcaacccggggacagg
gtcggggtcatgctggcccgctctcccctggccatcttcacccagctggcggtgctgctg
gcgggcgccgtctatgtgcccctcgaccccgagcagccgctggagcgccagggccatata
ctgcgccttggggaggtcaagaccctgatcacccaggcggagtatcgccacaagctggcc
agcctgttcgaggggcgcacgctcctggcgggggatctggtgagcgacaaccgcttgaac
cagccagccgccggccgcgccgtcgcctacctgatgttcacctcgggctcgaccggccta
cccaagggggtggcggtcagtcacggggcgctcgatcacttcgccgctgccgcccgctgc
cgctatcacctgaacgagggggcccggatgttgcaatttgcccccttcaatttcgacgcc
agcatagaggaggtgtttgccacactgagcgccggtgccaccctggtgctgcgtaccgac
gccctgctcgaatccatggccgccttcgcggccggggtggagcagatggggatcacccac
ctcgacctgcccaccgccttctggaacgagtgggtggtggcgctgacggcgggccaggcc
cacattccggcctcccttgccaccgtcatcataggcggcgaggcggtttaccccgagcaa
ctggcccagtggcagcgccaaggtcgctcagatgtgcgtctgttcaacacctatggcccc
accgagaccactgtggtggtcactacccaggagctgcagcaggaagacccgaaccaggcc
cagctgcccatcggtctgccgctgcccggcatgcaggcgctcattctgggggcaggggaa
cagcctgccagcgagggggagatggtgctgctcggcccacagcttgccaacggctatgtg
ggtggcgtgcaggggagctttgagacccttagggtcggtgagcaggcgctgcccgtctat
cgcacaggcgatcgggtgcggctggcggccggccggctggtctatctgggccggcgcgac
aacgaattcaagatcagcggctatcgcatccagcccggcgaggtggaggctcaactgctg
gccctgcccggggtggacgaggcctgcgtgcagggggtgagcatcggcagcgtacgccgg
ctggtggccttcgtggcaggcagcgagcgcgacagtcgggccatcaaggcgcagctcgcc
aagatgctgcccgccgccatgatccccaccgactatcgccactatgaccagctgccccgc
accggctccaacaagctggatcgcaaggccctgctggctcagtaccagtccacggatgag
gcactgaccctcggcagtgaaaccgagaaccgggtcggcgccatctggcagcagatcctg
gggctggccaccatggcgccggcggacaacttcttcgagctgggggggcagtccctgcag
accatacagatagtgaaccggctcggtgccgagttcggggtgcaggtcaaggtatccgat
gtgttcgaccacccccgtctggacgacttctgccgcttcctcgacggcaagctgaccgag
gatgaagagagtgtggagatggtctggtga

DBGET integrated database retrieval system