KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1843Help
Entry
ASA_1843          CDS       T00500                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding TubC_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABO89919
UniProt: A4SLZ7
Position
1935791..1942027
Genome map
AA seq 2078 aa AA seqDB search
MNNMITLLKQLERQGVRLALNEKGQLISQSSKEALTPAIGTQIKAHKDELVRCLAARAAF
EAPIVAQGAQSGPLSSSQSGLWFIEQYEEASHLYNMPVYFRVRGELDTRALEFAFDHLFA
RHPSMRTRFIKDEAGRGAQEILPHLPFTLPVEDVSQQPQAEREAYVARRVREEIGRPFSL
TKGDLSRVHLIRLGSHEHVLLITQHHIVSDGWSVKNMFADLKRAFLAHQNREPLSVPELP
LTYLDYAHWFNSPRFLDYHAEFKPFWVDRLGGSPEVHGLPLDKPRPAHQASGGELVFSTI
DNTLWESFKRLCQRHNTSNFIGLHALFALLMVRQSGEKEVVIGTPLAYRERHEIESLVGF
FVNTLVLRTRLDGRPSFVDYLQQCREEDLAAFDHQLYRFEALAEAIGADRTTAINPIFQI
MLVYQAKVDFNDLIPGCQLVEETSPVLPAKTDISVKVTELMDSVRVDWLFATALFERETI
QSYADRLLHLMRAVVAAPETDIWQLPLEAGTDQAALAAELASLPLDYPSRDTLLCHIERR
AAERPDALAVSDGEGALSYGELEARANRLAHWLLTRGVKPGAAIGIQARRDVAFAVALLA
CWKAGAAYVPLDPAYPAERLAHILGDASIVLVLGGEPDARLAEAIKGTDAGYHNLHRLAL
DGLPSKAPTIPRDAAMLAQIIYTSGSTGLPKGVMVEQGSLVNLMADHGARIVLDQDGAMF
NCMSLSFDAGNMTTLLPLYCGAALHFGEPGEGAITAAINCGASHMILPTALLANLLPPTD
LGSLRAIGFGGEACPSSLVERWGERIALFNMYGPTECTVTALCARLVPGQPITIGQPISN
LKALILDEGGNLCPVGVPGELCLSGLGLARGYLNLPERTQEAFIDLALAGRTYRLYRTGD
RALRRRDGNIQYLGRIDEQIKLRGYRIEPGEIETQVAALCPAIRQIKVVVQEGRLLAYAC
LHEGASEPDGEALLQRAGECLPEYMVPVRLCWLPEMPLTPNGKLDVRRLPAIDWQQSKSE
PQSELEQTVLAIWQGVLKQPLGVEDDFFRLGGDSILSIQLTTRLRDAGLHCSVKDVFEAK
TVRRLCRQLGQQQAVSHQTEQGNLVGDFPLHPIQHWFFEQGFAKPGHWNQGVILRLPAGI
DDDTLAGWLTTLRQHHDALRLAVTPSGQRYLAELALPPLPTLDAGTLGGAELQARLTELQ
GDLEPASGHTLAWTRLRNLAIEGEAEPVEGLFLAFHHLVIDAVSWRILAEDLARVSRGEP
LPAKGSSYRQWGEGLAAYALREEDQLAFWLAQGEGSQQGLLEAERAEDGRAAASLLQLDK
ETTARLIDPANQAFFTRVPDLLLAALTRTLSELGYGARHCVMLEGHGREAIDAEIDVSRT
LGWFTSTYPLALADEQEWDALVCATKERLRAVPDKGVGFNALRLHHPRGWELPEALIVFN
YLGVSHQGAAGQPWQPLPMAPGAPTSPDNLPRELISLHGGVYDGCLTLRQVGALNQQGSD
ALMVRLFANLKALVDHCCGVSAPRHTPSDFPGLGLSQSALDQVLSGREVETLLPMTSLQQ
SMLYHRALAPRDTAYHLQTEMAYHQPLDLAVYRQAWQAQIARWPALRSELVLADGVALQR
ILRHAELPFHYQDLVGDEQAEARIAAYRQQDLARPIPLEQAPLLRVACFKLAPDHHKVIF
SAHHGVLDGWSGPVLLGSLHRCYQALMNGLLPQAEADGAWLEFGRHIASQTRASEAYWQG
RAEQLARPNDLSRLFGVALEPQLTQHRPAVCGQTLAPHVSAQLEARARELGVTTGLLAQY
AWHRLLARCCGDDITLVGNVTPGRDFPIEGITQSVGLYINSLPLILDWRTEATLAEHIAR
LQSDLMALNEHGTQSLAALTQGRARLFQSLFVFENYPVPALPEEPEPHQLVPRFGAVVEK
VELPLSLVVNARGGQFNLRFEFDGDLIPMAKAEAVLAAWLTELGWLAGASLALPARPDEM
SLPAPVAARVAAPVAEPCPPAARPLVALWERQCGVPGVWQQTLCELGVDSVQQLALLAAL
NAAFAGERAPLTLRDLKAHSSPSRLYQHWLVRLPEEVL
NT seq 6237 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatatgataacgctgctaaaacagctggaacgccagggtgtcaggctggccctc
aacgagaaagggcagctgatttcccagtcgagcaaggaggcactgacccccgccatcggc
acccaaatcaaggcgcacaaggatgagctggtgcgctgtctggcggcccgcgccgccttc
gaggcacctatcgtcgcccagggagcccagagcgggccgctctcttcctcccagagcggg
ctctggtttatcgagcagtatgaggaggcctcccatctctacaatatgccagtctacttc
agggtccgtggcgagctggatacccgagccctggaatttgccttcgatcacctgtttgcc
cgccaccccagcatgcgcactcgcttcatcaaggacgaggcgggcaggggggcccaggag
atactgccgcaccttcccttcaccttgcctgttgaagacgtcagccagcagccgcaagcc
gaacgcgaggcctatgtggccaggcgggtgcgcgaggagatagggcgccccttctctctg
accaaaggggacttgagtcgggtgcaccttattcggttggggtctcatgaacatgtgctg
ttgatcacccagcaccacatcgtctcggacggctggtcggtcaagaacatgtttgccgac
ttgaagcgcgccttcctggcccatcagaaccgggagcccttgagcgtgcccgagttgccg
ctcacctatctcgactatgcccactggttcaattcgccgcgctttcttgactatcacgcc
gagttcaagccgttctgggtcgaccggctcggtggcagccccgaggtgcacggcctgccg
ctggacaagccccgcccggcccatcaggccagcggcggcgagctggtcttctccaccata
gacaacaccctgtgggagagcttcaaacggctgtgccagcgccacaacacctccaacttc
atcggcctgcatgccctgtttgccctgctgatggtgcgccagagtggcgagaaggaggtc
gtcataggcacgccgctcgcctaccgcgagcgccacgagatagagtccctggtgggcttc
ttcgtcaataccctggtactgcgcacccggctcgacggtcgccccagctttgtcgactac
ctgcagcagtgtcgggaggaggatctggcggccttcgatcaccagctctaccgcttcgag
gcgctggccgaggccataggcgccgatcgcaccaccgccatcaaccccatcttccagatc
atgctggtctatcaggccaaggtggatttcaacgatctcatccctggctgccagctggtg
gaggagacctcgccggtgctgcccgccaagaccgacatctcggtcaaggtgaccgagttg
atggattccgtcagggtggattggctgttcgccaccgccctgttcgagcgagagaccatc
cagtcttacgccgatcgtctgctgcacctgatgcgcgccgtggtggcggcccccgagacc
gacatctggcagctgccgctggaggcgggcacagaccaagcagcgctggccgccgagctc
gccagcctgcccctggattaccccagccgcgacaccctgctctgccacatagagcgccgc
gcggcggagcgtcccgacgcgctggcggtgagtgatggcgaaggcgccctgagttacggc
gagctggaggcgcgcgccaaccggctggcccactggctgctgacccgaggcgtgaagccg
ggcgccgccatcggcatccaggccagacgggatgtggctttcgcggtcgccctgctcgcc
tgctggaaggcgggggcggcctatgtgccgctcgatcccgcctatcccgccgagcgattg
gcccatatcctcggtgacgccagcattgtgctggtgctgggaggagagccggatgcccgg
ctcgccgaagccatcaagggcacagatgccggttaccacaacctgcatcggctggcgctg
gatgggctgccaagcaaggctcccaccatcccccgggacgcggccatgctggcccagatc
atctacacctccggcagtaccggcttgcccaagggggtcatggtggagcagggcagcctg
gtcaacctgatggcggatcacggcgcgcgcatcgtccttgatcaggatggcgccatgttc
aactgcatgtccctgtcgttcgatgcgggcaacatgacaaccctgctgccgctctactgc
ggcgcggccctgcactttggcgagccgggcgagggggccatcacggccgcgatcaactgt
ggcgccagccatatgatcctgcccaccgccctgctggcgaacctgttgccaccgaccgat
ctcggttctctgcgcgccatcggttttggcggtgaagcctgcccgagcagcctggtggaa
cgctggggggagcggatagcactctttaacatgtacggcccgaccgagtgcacagtcacg
gcgctctgcgcgcggctcgtgccgggtcagcccatcaccataggccagcctatcagcaat
ttaaaagcgctgatcctggacgaagggggcaacctctgccccgtcggtgtgcccggtgag
ctctgcctgagtggtctcggccttgcccgtggctacctcaatctgcctgagcgtactcaa
gaggcctttatcgatctcgccttggcgggtcgtacttatcgcctctaccgcacaggcgat
cgggcgctcaggcgccgcgacggcaacatccaatatctgggccggattgacgagcagatc
aagctgcggggctatcgcatcgagcccggcgagatagagacgcaagtcgccgcgctgtgc
ccggccatccgccagatcaaggtggtggtgcaggagggtcgcctgctggcgtacgcctgc
ctgcatgagggggcgagcgagccggacggcgaggccctgctgcaacgggccggtgaatgc
ctgcccgaatacatggtgccggtgcggctctgctggctgcccgagatgccgctcaccccc
aacggcaagctggatgtgcgccgcctgcccgccattgattggcagcagagcaagagtgag
ccacaaagcgagctggagcagactgtgctcgccatctggcagggggtgctcaagcaaccc
ctcggggtggaggatgacttcttccgcttggggggagattccatcctcagcatccagctc
accacaaggctgcgggatgcggggctgcactgcagcgtcaaggacgtgttcgaggccaag
actgtgcgccgcctctgccgccagctcggccagcagcaggcggtcagccaccagaccgaa
cagggcaacctggtcggcgacttcccgctccatcccatccagcactggttcttcgagcag
ggcttcgccaagccaggccactggaaccagggggtaatactgcgcctgcccgccgggatc
gatgatgacaccctggccggctggctgaccacactgcgccagcatcatgacgccctgcgt
ctggcggtgaccccgagcggtcagcgctatctggccgagctggcgctgccgccgctgccg
accctggatgcaggaacactcggcggggctgaactgcaggcccgcctgaccgagttgcaa
ggggatctggagcctgccagcggccacaccctggcctggacccgcctgcgcaacctggcc
atcgagggcgaggcagagccggtggaggggcttttcctcgccttccaccatctggtcatc
gatgccgtctcctggcgcattctggccgaggatctcgcccgggtgagcaggggcgagccc
ctgcccgccaagggcagcagctatcgccagtggggcgaagggctggccgcctacgccctg
cgcgaagaggatcaactggcgttctggctggcccagggggaaggtagtcagcaaggtctg
ctggaggccgaacgcgccgaagatggccgcgccgccgccagcctgctgcaactggacaag
gagaccacggcccgcttgatagacccggccaatcaggccttcttcacccgggtgcccgac
ctgctgctggccgccctgacccgcaccttgagcgagctgggttatggcgcacgccactgc
gtgatgctggaagggcacggccgtgaggcaatcgatgctgaaatcgatgtgagccgtacc
ctgggctggttcaccagcacctatccgctggcgctggccgatgagcaagagtgggatgcg
ctggtgtgcgccaccaaggagcggctgcgggccgtaccggacaagggggtaggcttcaac
gcccttcgtctgcaccatccccgtggttgggagctgcccgaagccctcatcgtcttcaat
tacctgggggtcagccatcagggcgctgcaggtcagccctggcagcccctgcccatggcg
ccgggggcgcctacttcgccggacaacctgccgcgggagctcatcagcctgcacgggggc
gtctatgacggctgtctcaccctgcgccaggtcggcgccctcaaccagcaagggagcgac
gccttgatggtgcggctttttgccaacctgaaggcgctagtggatcactgctgtggggtg
agcgccccgcgccacaccccgagcgacttcccggggcttggcctctcgcaatcggcgctc
gaccaggtgctgagcgggcgcgaggtggagacactgctgcccatgacgtccttgcagcag
agcatgctctatcacagggcgctggcgcctcgtgatacggcttaccatctgcagaccgaa
atggcgtatcaccagccactggacctggcggtctaccgccaggcctggcaggcgcagatc
gctcgctggccggccctgcgcagcgagctggtgctggcggatggggtggcactgcagcgc
atcctgcgccatgccgagctgccattccactatcaggatctggtgggggatgagcaggcc
gaggcgcgcatcgcggcctatcgccagcaggatctggcccgcccgatcccgctggagcag
gctcccttgctgcgggtcgcctgcttcaaactggcacccgatcaccacaaggtcattttc
agtgcccaccatggcgtgctggatggctggagtggtcccgtattgctgggctccctgcat
cgctgctatcaagccctgatgaacggcctgctgccgcaagccgaagcggatggggcctgg
ctcgaatttggccgccatatcgcgagccaaacccgcgccagcgaggcctactggcaggga
cgcgcggagcagctggcccgacccaatgatctctcccgcttgtttggggtggcgctggag
ccgcagctgacgcagcacaggcctgcggtgtgcggccagaccctggcgccgcacgtgtcg
gctcaactggaagcccgcgctcgcgagctgggggtgaccacgggcttgctggcccagtat
gcctggcatcgcctgttggcccgctgctgtggcgacgacatcaccctggtgggcaacgtg
accccaggccgggatttccccatcgaggggatcacccagagcgtcggcctctatatcaac
agcctgccgcttatcctggattggcgcaccgaggcgaccctggccgagcatattgcccgg
ctgcagtcggatttgatggccctcaatgagcacggcacccagtcgctcgccgcgctgacg
cagggcagggcgcgcctgttccagagcctgttcgtgttcgagaactaccctgtgccggcg
ctgccggaggagccggagccccatcagctggtgccgcgctttggcgccgtggtggagaag
gtggagctgccgctctccctggtggtgaacgcccgcggcggtcagttcaatctgcgcttt
gagttcgacggggatctgatccccatggcgaaggccgaagccgtgctggccgcctggctg
accgagcttggctggctggcgggggcgagccttgcgctgccggccagacccgatgagatg
agcctgcctgcccccgtggcagcgcgcgtcgcggcgccagtcgctgagccctgcccgcct
gcggctcgtccgctggtggccctgtgggagcgccagtgcggcgtgcccggcgtctggcaa
cagaccctgtgtgaactcggggtggattcggtgcagcagctcgccttgctggcggccctc
aatgccgcctttgccggcgagcgagcgccgctcactttgcgggatctcaaggcccattca
tcccccagccggctctatcagcactggctggtgcgactgcccgaggaggtgctatga

DBGET integrated database retrieval system