KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1852Help
Entry
ASA_1852          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretin_N CUE
Motif
Other DBs
NCBI-ProteinID: ABO89928
UniProt: A4SM06
Position
1952057..1952866
Genome map
AA seq 269 aa AA seqDB search
MVIARLAEAVSRASGQEREMKRWRWSGILLLWGFWCLPLRAEVKVIPVFEAEAMVQTLKE
IYPDLGVSAMGNQLVLSGSAAQLQEAEATLAKLNQPPQSLFVEWRVDGASSGQQIEAGIG
GDAAKRQWLLEGNARQYQRSQNDSWQVRGLSGRPVLLQMGSYQPVTFYQWRGGQVVGLMP
LINGLYATATLIGDRVQIALSSEQARLEQGTVTTGQNATEVSGAPGQWLTVGELSTSSAQ
QGSSLGTQLQGGSGTQSDRQTLQIRVTRQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagccagactggcagaagcggtgagccgggcttccggacaggagagagagatg
aaaaggtggcgttggagcgggatcttgttgctgtgggggttctggtgcctgccgctgcgg
gccgaggtcaaggtgatcccggtattcgaggccgaggccatggtgcagaccctcaaggag
atctacccggacctcggggtgagtgccatgggcaaccagctggtgctgagcggcagtgcg
gcccagttgcaggaggccgaagcgaccctggccaaactcaaccagccgccccagagcctg
tttgtcgaatggcgggtggatggtgcctcaagcggtcagcagatagaggcgggtatcggt
ggtgatgcggccaaacggcaatggctgcttgagggcaatgcccggcaataccagcgcagc
cagaacgacagctggcaggtgcgcggcctgtcggggcggcccgtgttgctgcagatgggc
tcctaccagccggtcaccttctatcagtggcgcggtggtcaggtggtgggcttgatgccg
ctcatcaacggtctctacgccaccgccaccctgataggggacagggtgcagatagcgctc
agcagcgagcaggccaggctggagcagggcaccgtcaccacggggcagaatgccaccgag
gtgagcggcgccccgggtcagtggctgacggtaggggagttatccaccagctcggcgcag
caagggagcagcctgggtacccagttgcagggggggagtggtactcagagcgatcgccag
accctgcagatccgggtcacgcggcaatga

DBGET integrated database retrieval system