KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1857Help
Entry
ASA_1857          CDS       T00500                                 

Gene name
etfA
Definition
(GenBank) electron transfer flavoprotein alpha-subunit
  KO
K03522  electron transfer flavoprotein alpha subunit
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asa04147]
    ASA_1857 (etfA)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ASA_1857 (etfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF ETF_alpha
Motif
Other DBs
NCBI-ProteinID: ABO89933
UniProt: A4SM11
Position
1957521..1958450
Genome map
AA seq 309 aa AA seqDB search
MSVLVIAEHHQGKLADNVAQLVTAAGQLGGEVHLLLLGQGLTEAGEQGASLQGVDRVLLA
EHPMLAEGLNDGVDPLLSDIARDYQHCLMAASTQGKDMLPRVAARLGMEMLSEVIGIESG
DTFLRPIYAGNAIARVASSAPIKVLTIRPTAFAKAEFGTGQAAVERLPVADVACRTRLVE
RRAVLSVRPELAAARVVVSGGRALGSKAQFALIEALADKLGGAVGASRAAVDAGFVANDL
QVGQTGKVVAPELYIAVGISGAIQHLAGMKESKVIVAINKDSEAPIFQVADYGLVGDLFT
LLPELTAKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactggttattgctgaacatcatcagggcaagcttgccgacaatgtggcccaa
ctggtcacggcagcgggccagctcggcggcgaggtgcatctgttgctgctgggccaggga
ctgaccgaggcgggcgagcagggtgccagcctgcaaggagtggacagggtgctgctggcc
gagcatcccatgttggcggaagggttgaacgacggcgtcgatcccctgctgtctgatatt
gcacgggactatcagcactgcctgatggcggcgagtacccagggcaaggatatgttgccc
agggtggcggcacggctcgggatggagatgctctccgaggtgatcggcatagagagtggc
gataccttcctgcgccccatctatgcgggcaacgccattgccagggtagcgagctcggcg
cccatcaaggtgctgaccatcaggccgaccgcctttgccaaagccgagttcgggactggg
caggctgcggttgagcggctgccggtggccgatgtggcatgtcgtacccgtctggtcgag
cgccgcgccgtgttgtccgtcaggccggaactcgcggcagcgcgggtcgtggtctccggc
ggacgggcccttggctccaaggcgcagtttgccctcattgaagcgctggccgacaagctg
ggcggggcggtgggggcctcgcgcgccgccgttgacgccggttttgtggccaacgatctg
caggtgggtcagaccggcaaggtggtcgctcccgagctctatatcgcagtcggcatctcg
ggggccatccagcatctggcgggcatgaaggagtcgaaggtgatagtggccatcaacaag
gacagcgaggcccccattttccaggtggcagactacggtctggtgggggatctgttcacc
ctgctgcccgagctcaccgccaaactctga

DBGET integrated database retrieval system