KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1858Help
Entry
ASA_1858          CDS       T00500                                 

Gene name
serC
Definition
(GenBank) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00260  Glycine, serine and threonine metabolism
asa00680  Methane metabolism
asa00750  Vitamin B6 metabolism
asa01100  Metabolic pathways
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
asa01200  Carbon metabolism
asa01230  Biosynthesis of amino acids
Module
asa_M00020  Serine biosynthesis, glycerate-3P => serine
asa_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:asa00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ASA_1858 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASA_1858 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASA_1858 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asa01007]
    ASA_1858 (serC)
Enzymes [BR:asa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     ASA_1858 (serC)
Amino acid related enzymes [BR:asa01007]
 Aminotransferase (transaminase)
  Class V
   ASA_1858 (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABO89934
UniProt: A4SM12
Position
1958675..1959763
Genome map
AA seq 362 aa AA seqDB search
MSKQIYNFCAGPAMLPVEVMERAQREFCNFQGLGASVMELSHRGKPYMAVAEKAEADLRD
LLAVPDNYKVLFMHGGGRGQFSAVPMNLLGGANKKADFLLTGVWSQSAVDEARKYGDIQT
VQGVAKNEQGISHLLQSPAFRADAAYVHYCPNETIDGIEMFDIPATGDVPLVADLSSTIL
SRPMDVSRFGVIYAGAQKNIGPSGLAIAIVRDDLLNQARADVPSIFDYQLTAKNDSMFNT
PPTYAWYLAGLVFEWLKEQGGLEAMAARNKAKADFLYGYLDDSSFYGNKVDVSCRSRMNI
PFQLKNDALDKQFLAESEAAGLLALKGHRIVGGMRASLYNAMPLEGVKALVSFMDGFAKR
HG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacagatttacaacttctgcgccggcccagccatgttgccggttgaagtcatg
gagcgcgcccagcgcgaattttgtaattttcaggggctgggagcctcggtcatggagctg
tcccatcgcggcaagccttatatggcggtcgccgagaaggccgaagccgatctgcgcgac
ttgctggcggtgccggacaactacaaggtgctcttcatgcacggtggtggtcgcggccag
ttctccgccgtgcccatgaatctgctgggcggggccaacaagaaggctgacttcctgctg
accggtgtctggtcccagagtgcagtggatgaagcccgcaagtatggtgatatccagacg
gtacaaggggttgccaagaacgagcaggggatctcccatttgctgcagagtccggcgttt
cgcgccgatgcagcctatgtgcactactgcccgaacgaaaccattgatggcatagagatg
ttcgacatccctgccaccggcgatgtgcccctggtcgccgatctctcctccaccatcctc
tcccgtcccatggatgtgagccgttttggggtcatctacgccggagcccagaagaacata
ggcccgtcagggctggccatcgccatcgtacgtgacgatctgctgaaccaggcgagagcc
gacgtgccctcgatttttgactaccagctcactgccaagaacgactccatgttcaatacc
ccgcccacctatgcctggtatctggccggtctggtgttcgagtggctgaaagaacagggt
gggctcgaggcgatggccgcgcgcaacaaggcgaaggccgatttcctctacggctacctc
gacgactccagcttctacggcaacaaggtggatgtcagctgccgttcccgcatgaacata
cctttccagctgaaaaatgacgccctggacaagcagttcctggccgagtccgaagccgcc
ggtctgttggcactgaaagggcaccgtatcgtcggtggcatgcgcgccagcctctataac
gccatgccactggaaggggtcaaggccctggtgagctttatggatggctttgccaagcgc
cacggctga

DBGET integrated database retrieval system