KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1860Help
Entry
ASA_1860          CDS       T00500                                 

Gene name
aroG
Definition
(GenBank) 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01130  Biosynthesis of antibiotics
asa01230  Biosynthesis of amino acids
asa02024  Quorum sensing
Module
asa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:asa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASA_1860 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASA_1860 (aroG)
Enzymes [BR:asa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ASA_1860 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABO89936
UniProt: A4SM14
Position
1961446..1962501
Genome map
AA seq 351 aa AA seqDB search
MQHQTDDVRISEIKELLPPVAVLEKFPATETASNTVFESRQAIHQILAGEDQRLLVVIGP
CSIHDPVAALEYGKRLKTLRDELKGQLEIVMRVYFEKPRTTVGWKGLINDPYLDNTCKIN
DGLRIGRKLLLDLNDMGLPTASEFLDMITPQYVADLMSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGTIKVAIDAIGAASAPHHFLSVTKYGHSAIVATRGNPDCHIILRGGREPN
YSAAHVDEVVKGLDKAGLPQKVMIDFSHANSSKQFKNQMLVAEDVAGQLRAGSKAVFGVM
VESHLVEGRQDLVEGCELTVGQSITDACIGWADTEVLLRNLADAVATRNAG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcaaaccgacgacgttcgtatcagtgaaatcaaagagttattacccccggtt
gcggtgctcgagaagtttccggccaccgagaccgcatcaaataccgtattcgaatcccgc
caggccattcatcagatcctggccggtgaagatcagcgcctgctggtggtgataggtccc
tgctccatccacgaccccgtggccgcgctggaatatggcaagcgtctcaagaccttgcgt
gacgagctcaagggccagctggaaatcgtgatgcgagtctacttcgagaagccccgcacc
acagtgggctggaaggggctgatcaacgacccttacctcgacaacacctgcaagatcaac
gacggcctgcgcatcggtcgcaagctgctgctggatctcaatgacatggggctgccgacc
gcctccgaattcctcgacatgatcaccccgcaatacgtggcggatctgatgagctggggc
gccatcggtgcccgtactaccgaatcccaggtgcaccgtgagctggcctccggtctttct
tgcccggtgggcttcaagaacggcacggatggcaccatcaaggtggccatcgatgccatc
ggtgccgccagcgcgccgcaccacttcctgtcggtcaccaagtatggccactccgccatc
gtcgccacccggggcaacccggattgccacatcattctgcgcggtggccgcgagccgaac
tacagcgccgcccatgttgacgaggtagtgaaggggttggacaaggccggtctgccgcaa
aaggtgatgatcgacttcagccacgccaacagcagcaagcagttcaagaaccagatgctg
gtggccgaagatgtggccggtcagctgcgtgccggcagcaaggcggtatttggcgtcatg
gtggagagccacctggtggaaggccgtcaggatctggtggaagggtgcgagctcaccgtc
ggtcagagcatcacggatgcctgcatcggctgggccgataccgaagtcctgctgcgcaat
ctggcggatgcggtggctacccgcaacgcaggctga

DBGET integrated database retrieval system