KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1862Help
Entry
ASA_1862          CDS       T00500                                 

Gene name
hugW
Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K21936  anaerobilin synthase [EC:2.1.1.342]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASA_1862 (hugW)
Enzymes [BR:asa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.342  anaerobilin synthase
     ASA_1862 (hugW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ABO89938
UniProt: A4SM16
Position
1964450..1965817
Genome map
AA seq 455 aa AA seqDB search
MTLHLTPTMTGLSTPDPLKFAFSAKTSAHASRGGIRPFSLDDAGWQAWWQQGSQADERAL
YIHVPFCRKRCSFCNFFENGANPARMSRYMAALCDSLNRAADTPLAQSRPFSAVYVGGGT
PTDMALEDLARLARAIQRFPLTLDAEVTLEGRLNGFDDAKWQTALAGGFNRFSFGVQSFD
TRVRQQAARFDDRQTLLARLGELTQDDAAVIVADLIFGLPGQDDEVWRQDIADVMASGVH
GVDLYQLIPMAGTNLERAEASGKLGWAADGQQRAAMYAYGAQTLEQGGWQRLSCSHWRRD
DAEQSRYNQMAKRGAEILPFGAGAGGSVHGHGLMYGRDLALWHEALAGGVRAPGMVMGQN
PNAPMDGLLRGALDSGRLTLDRLPVPLRAHLLPLFQAWQLHGLVALTEDKLVLTLAGRFW
NVNLQAGLFEFLQLNPLGGVQSAVHSTEAVRHSLV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacattacacctgaccccgaccatgaccggactctctacgccggatcctctcaagttt
gccttcagcgccaaaacctctgcccacgccagccggggcggcattcgccccttttccctc
gacgatgcaggctggcaagcctggtggcagcaagggagccaggccgatgagcgtgcgctt
tacatccatgttccgttttgccgaaagcgctgcagcttctgcaatttcttcgaaaatggc
gccaatccggcgcgaatgagccgctatatggccgccttgtgcgatagcctgaaccgggca
gcggatactcccttggcccaaagcagacccttttcggctgtctatgtgggaggcggcacg
ccgaccgacatggcactcgaggatctggcgaggctggccagggcgattcaacgctttcca
ctgaccctagatgccgaggtgaccctggaagggcgcctcaacggttttgatgatgccaag
tggcagacagcgctggcggggggcttcaaccgcttctcgttcggggtacagagttttgac
acccgggtgcgccagcaggctgcccgcttcgatgacaggcagaccctgctggctcgtctc
ggcgagctgacccaagatgatgcggccgtaatagtggcggatctcatcttcggcctgccg
ggtcaggatgacgaggtatggcgccaggatattgcggatgtgatggcaagcggggtacac
ggcgtggatctctatcagctcatccccatggcaggtaccaacctggagcgggccgaggcg
agcggcaagctgggctgggcggccgatggtcagcagagggccgccatgtacgcctacggt
gcccagacactggagcagggcggctggcagcggctctcctgcagccactggcggcgcgac
gatgccgagcagagccgctacaaccagatggccaagcgcggcgccgagatccttcccttc
ggggcgggggccggaggtagcgtgcatggccatggcctcatgtatggccgggatcttgcc
ctctggcacgaggcgctggctggcggtgtgcgagcgcctggcatggtgatggggcagaac
cccaatgctcccatggacggcctgctgcgcggtgccctcgacagcggcaggttgacgctg
gatcgcctgcccgtgccgctgagggcccatctgctgccgctctttcaggcttggcagttg
cacgggctggtagcgctgacagaggacaagcttgtgttgaccctggcggggcgtttctgg
aacgtcaatctgcaggcgggcttgttcgagttcttgcagctcaacccgctgggtggtgtg
cagagcgccgttcattcgactgaagccgtgcgtcactcgctggtgtaa

DBGET integrated database retrieval system