KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1864Help
Entry
ASA_1864          CDS       T00500                                 

Definition
(GenBank) cytochrome b561 family protein
  KO
K12262  cytochrome b561
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    ASA_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB Cytochrom_B561
Motif
Other DBs
NCBI-ProteinID: ABO89940
UniProt: A4SM18
Position
1967568..1968119
Genome map
AA seq 183 aa AA seqDB search
MNSSIPLSLTTRLLHWSVALLMIGLTLLGYLMVKFEIWDLYALHKSLGVIALVLILPRAI
IRFGKGWPTPVRQYPAYEALAAKAIHWGLLVSTLLIPVSGLCYSGAAGRGVALFGWFIIP
MNPDINDPANVIPYSESIRDIAHTVHVYLPYIMLAMLLAHIVGALKHHLLDKDLTLLRML
GRK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctcgatcccgttaagtttgacgacccgtttgctgcactggtcggtcgccttg
ctgatgattggcttgaccctgctgggttatctgatggtgaaatttgaaatatgggatctc
tacgccctgcataaatctctgggggtcattgcactggtattgatcctgccacgcgccatt
atccgttttggcaaagggtggccgacgccagttcgccaatatcccgcttacgaggcattg
gctgccaaggcgatccattggggattgcttgtttcgaccctgcttattccggtttcaggt
ctctgctattccggcgcggccgggcgtggcgttgccctgtttggctggtttattatcccg
atgaatccagatatcaatgatcctgccaatgtcattccatacagtgaatccattcgggat
attgcccataccgtccatgtttatttgccctatatcatgctggccatgttgctggctcat
attgtcggggcgttaaaacatcacctgttggataaagaccttaccttgctgcgaatgctt
ggccggaaataa

DBGET integrated database retrieval system