KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1866Help
Entry
ASA_1866          CDS       T00500                                 

Gene name
exbB
Definition
(GenBank) MotA/TolQ/ExbB proton channel family protein
  KO
K03561  biopolymer transport protein ExbB
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
Transporters [BR:asa02000]
 Other Transporters
  Pores ion channels [TC:1]
   ASA_1866 (exbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB MLANA Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ABO89942
UniProt: A4SM20
Position
complement(1968826..1969578)
Genome map
AA seq 250 aa AA seqDB search
MDPEIANNGMGVAHLLSQNTGVGLLPFILLVLMSLGTCYYTLLKIVLGQRERRLNAQFVT
RFWQHESVQDMERQLAHLTPQEAYGRVTSTALATVAQLNRAGERTVSLKLGSPDEFLLRA
LRQAITHERVRLERGLAFLASVGSAAPFIGLFGTVWGIYHALLAIGAAGQSSLDKVAGPV
GEALIMTGFGLAVALPAVLVYNFFVRRNRLKLAALEAFAYDLFALLVTGFEQSTSNVTQL
AERETGKGRR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggatccggaaattgcaaacaacgggatgggcgtcgcccatctgctcagtcaaaatacc
ggcgtggggctgctgccattcattttgctggtattgatgtccctcggcacctgttattac
accctgctgaaaatagtgctgggtcagcgcgagcgccgcctcaacgcacaattcgtgacc
cgcttctggcagcacgaaagcgtgcaggatatggagcgccagctggcccatctcacgccg
caggaggcctatgggcgtgtgaccagcacggcgctggcgacggtggcgcaactgaaccgg
gctggggagcggacagtgtcgctcaagctgggttcaccggatgagtttttgctgcgagca
ctgcgccaggccattacccatgagcgggtacggctggaacggggccttgccttcctcgca
tcggtaggttcggcggccccttttatcgggctgttcggtaccgtctggggtatctatcat
gcactgctggccataggtgcggcaggccagagcagcctggacaaggtggcaggccccgtg
ggtgaagccctgatcatgacgggatttggcctcgccgtcgccctgccggctgtgcttgtc
tacaacttctttgtgcggcgcaaccgcctgaaattggcagcgcttgaggcctttgcctac
gacctgtttgccctgctggtgacgggatttgaacagagcacctccaacgtgacccagctg
gccgagcgggaaaccggcaaggggcgcagataa

DBGET integrated database retrieval system