KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1867Help
Entry
ASA_1867          CDS       T00500                                 

Gene name
tonB
Definition
(GenBank) Periplasmic protein TonB
  KO
K03832  periplasmic protein TonB
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
Transporters [BR:asa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ASA_1867 (tonB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_C TonB_2
Motif
Other DBs
NCBI-ProteinID: ABO89943
UniProt: A4SM21
Position
complement(1969581..1970414)
Genome map
AA seq 277 aa AA seqDB search
MGHAAAIGACFHGLTHTFEYQYPEDREVMEACNPRPALTTDNPGSVRLCCLAITVVLHLA
VLWLIYENRPAAITPPLPLTLSARWVGDASVNDSPAKAAAAAIPTQAVVKKPVPAQKQAV
QKPASKPIPKQVPRPPTPKATQVARAEPVAAPSASATPVAANAPQGDSGSAPVKSRQSGS
GAGSSAPIARDARLNNPEPPYPYESRRRGEEGHVILNVLVAADGTASSVDVDKGSGYRRL
DMTARRTVSRWRFIPAKQNNAAVEAWAKVTIIFKLRA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggggcatgctgccgccattggagcctgctttcatggcttaacgcacacttttgagtat
caatatccggaggatagagaagtgatggaggcttgtaatccgaggccagcgctgaccact
gacaaccctggttcggtccgcctgtgttgccttgccatcactgtcgtcttgcacctggct
gtgttgtggctgatatatgaaaaccgccccgcagccatcacgccccccctaccgctgacc
ctgtctgcccgctgggtcggcgatgccagcgtcaatgactcaccggccaaagcggcagcg
gcggcaatcccaactcaagctgtcgttaaaaaacctgtacccgcccaaaagcaggcagtt
caaaaaccggccagcaagcccattcccaaacaggtacccagaccaccaacccccaaggcc
actcaggtggccagggccgaaccggtcgcggcgccctcggcctccgccacgccggtggct
gccaatgccccacaaggcgacagtggcagtgcgccggtcaagtcccggcagagcggcagc
ggggctggcagcagcgcccccatcgcccgtgatgcacggctgaacaaccctgagccaccc
tatccctatgaatccagaagacgtggcgaggagggacacgtcattctgaatgtactggtg
gcggctgatggcacagcctcctcggtggacgtagacaagggcagcggttatcggcggctg
gatatgacggcacgccggacagtcagtcgctggcgctttattcccgccaaacagaacaat
gcggccgtcgaggcctgggcaaaggtcaccatcatttttaaattaagggcttga

DBGET integrated database retrieval system