KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1868Help
Entry
ASA_1868          CDS       T00500                                 

Gene name
guaB
Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00230  Purine metabolism
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
Module
asa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:asa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ASA_1868 (guaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asa04147]
    ASA_1868 (guaB)
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     ASA_1868 (guaB)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ASA_1868 (guaB)
  Exosomal proteins of breast cancer cells
   ASA_1868 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth Glu_synthase PK DHO_dh ThiG NanE Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABO89944
UniProt: A4SM22
Position
1971116..1972579
Genome map
AA seq 487 aa AA seqDB search
MLRIAKEALTFDDVLLVPAHSDVLPNTADLRTQLTSSISLNIPMISAAMDTVTEARLAIA
LAQEGGIGFIHKNMSIEQQAAEVRKVKKYESGVVTDPVTVRPDMTIAQVKELSHKNGFAG
YPVVTEGNLLVGIITGRDVRFVIDLSQTVEQIMTQKDRLVTVREGAPREEVVALMQKHRI
EKVLVVNADFKLKGMITVKDFQKAERKPNACKDERGRLRVGAAVGAGAGNEERVAALVEA
GVDVLLIDSSHGHSQGVLDRIKATRDAYPELQIIGGNVATAAGALALVAAGVNAIKVGIG
PGSICTTRIVTGVGVPQITAISDAVDALEGTGVPVIADGGIRFSGDVAKAIAAGASCVMV
GSMFAGTEEAPGEIELYQGRSFKSYRGMGSLGAMSKGSSDRYFQTDNAADKLVPEGIEGR
VPYKGRLKEIIHQQMGGLRSSMGLTGCATIDDMRTKAEFVRISGAGMKESHVHDVTITKE
APNYRMG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggattgccaaagaagcgttaaccttcgacgatgtactgttggttcccgcccac
tccgatgttcttcccaatactgccgatctgcgtacccagctgacatcctctatcagcttg
aatatccccatgatttccgctgccatggacacagtgaccgaagcccgtctggctatcgca
ctggcccaggaagggggcattggctttatccacaagaacatgtccatcgagcagcaggct
gcagaagtgcgcaaggtcaagaagtacgagagcggcgtggtcactgaccccgtcacagta
cgccctgacatgaccattgcccaggtcaaggagctgagccacaagaacggcttcgccggc
tacccggtcgtgaccgagggcaacctgctggtcggtatcatcaccggccgcgatgtgcgc
ttcgtgatcgatctctcccagacagtcgaacagatcatgacccagaaagatcgtctggtg
acagtgcgtgaaggggcccctcgtgaagaggtggttgccctgatgcagaagcaccgtatc
gagaaggtgctggtggtcaacgccgatttcaaactcaagggcatgatcaccgtcaaagac
ttccagaaagccgaacgcaagccgaacgcctgtaaagacgagcgcggtcgcctgcgcgtc
ggtgccgccgtcggtgccggtgccggcaacgaagagcgcgttgcagccctggtggaagcc
ggtgtggacgtgctgctgattgactcctcccatggccactcccagggggtgctggatcgc
atcaaggcgacccgcgatgcctatcctgagctgcaaatcatcggtggcaacgtggccact
gccgctggcgccctggcgctggtcgccgctggcgtcaatgcgatcaaggtgggtatcggc
ccgggctccatctgtactacccgcatcgtgaccggtgtcggtgtcccccaaattaccgcc
atctccgacgccgttgacgcgctggaaggcactggcgtgcccgtgattgccgatggcggc
atccgcttctcaggcgacgtggccaaggccatcgccgctggcgccagctgcgtcatggtg
ggctccatgttcgctggtactgaagaagcgccgggcgaaatcgagctctatcagggccgc
tccttcaagtcctaccgtggcatgggttctttgggcgccatgtccaagggctccagtgac
cgttacttccagactgacaacgccgctgacaagctggtgccggaagggatcgaagggcgc
gtaccgtacaagggccgcctcaaagagatcattcaccagcagatgggcggcctgcgctcc
tccatgggcttgaccggctgcgccaccatagacgatatgcgcaccaaggccgagttcgtg
cgcatctccggcgccgggatgaaagagtcccacgtccacgatgtgaccataaccaaagaa
gcccccaactatcggatgggctga

DBGET integrated database retrieval system