KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1872Help
Entry
ASA_1872          CDS       T00500                                 

Definition
(GenBank) IS630-family transposase
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 HTH_23 HTH_28 HTH_32 HTH_33 HTH_29 LZ_Tnp_IS481 DUF1323
Motif
Other DBs
NCBI-ProteinID: ABO89947
UniProt: A4SLT7
Position
1977019..1978050
Genome map
AA seq 343 aa AA seqDB search
MPILPPLPRPQLRRIHKIIHATRDKGHARRLMAILLLHEGRTVTDVHHLTGAARSTIGRW
LRWYRDEGIDALEALPAGRAPVLPIAKMVTLLVLLMQFSPQDFGYQRSRWCTELLAIKIN
RLTGLNVAASTLRRWLPRMGIVWRRPVPTLRIKDPAYQEKMANIDAALARCNADNPVFYE
DEVDIDLNPKLGADWMFRAQQKRVVTPGQNAKHYLAGVLHAGNGRVLYVSGIKKNSSLFI
AMLEKLRHHYRRAKTITLILDNYIIHKSKQTERWLKKNPKFCLVFQPVYSPWVNHIERLW
HKSHETITRNHQCRGMANLLARVKYFMDTVSPFPGNGYGTAKV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcctaccacccctgccacgaccacaactgcgccgcattcacaaaatcatccat
gccacccgtgataaaggacatgctcgtcgcttgatggccatcttgctgttacatgaagga
cgtacggtcaccgatgttcatcaccttaccggcgctgcgcgctcgaccatcggtcgttgg
cttcggtggtatcgagatgaaggcatagatgcgctagaagccttaccggctggccgtgcc
ccagttttacctatcgccaagatggtcaccttactggtgctgctcatgcagttttctccg
caagattttggttatcagcgcagccgttggtgtaccgaactattggctatcaaaatcaat
cggttaacagggctcaatgtggccgcctccacacttcgtcgatggttacctcgtatgggg
attgtctggcgcaggcccgtgccgaccttgcggataaaagacccggcctatcaggagaaa
atggcgaatatcgacgccgcgctggcccgttgtaatgcagataatccggtgttttatgag
gatgaagtcgatatagacctcaatcccaaattaggggccgactggatgttcagagcgcaa
caaaagcgggttgtcactccggggcagaatgccaagcattacctggcaggcgttcttcat
gcaggcaacggaagagtgctttacgtcagcgggataaagaaaaactcatcgctgtttatc
gccatgctggaaaagctgcgccaccactaccgacgagccaaaaccatcacgctgatcctc
gataactacatcattcacaaaagcaaacagaccgagcgatggttgaagaagaaccccaag
ttctgcctggtattccagccagtttacagtccttgggttaatcacatcgaacggctgtgg
cacaagtcacatgaaaccatcacgcgcaatcatcaatgcagagggatggccaacctgctg
gctcgagtgaaatacttcatggataccgtgtctcctttccccgggaatggctatggcaca
gcgaaggtgtag

DBGET integrated database retrieval system