KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1882Help
Entry
ASA_1882          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilZ
Motif
Other DBs
NCBI-ProteinID: ABO89957
UniProt: A4SM35
Position
complement(1994551..1995126)
Genome map
AA seq 191 aa AA seqDB search
MQEQFFSVTHATPVNVIPMPGDFHLPTLEALEAELPEPFRIASSITSIDMVTSRLMRNQN
ESMHDLVEIVNQQSRKIDMIMGYVLSVQDHPEHRFHTLRFGAGQLTYLHPHQGHGEPPPL
HQIVRLKIFLREEASAIYCYAEVKQLDPSEHGTQVGLDYARIREDDRELLVRASLHVQSK
QLKLRAQDRQR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacagttcttcagcgtcacccatgccaccccggtcaatgtgatccccatgccc
ggtgactttcatctgccgacgctggaggcactggaggccgaactgcccgagccctttcgc
atcgcctcctccatcacctccatcgacatggtgaccagtcgcctgatgcgaaaccagaat
gaatcgatgcatgatctggtggaaatcgtcaaccagcagtcgcgcaagatcgacatgatc
atgggttatgtgctgtcggtgcaggatcaccccgagcatcgcttccacaccctgcgcttt
ggcgcaggccagcttacctacctgcatccgcaccagggccatggcgagccaccgcctctg
caccagatagtgcgactcaagatcttcctgcgggaagaggcctccgccatctactgctat
gccgaggtcaagcagctggacccgagcgaacatggcactcaggtggggctcgattatgcc
cggatccgtgaggatgaccgcgaactgctggtccgtgccagcctgcatgtccaatccaag
caactcaaattgcgtgctcaagaccgtcaacgttaa

DBGET integrated database retrieval system