KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1884Help
Entry
ASA_1884          CDS       T00500                                 

Gene name
lolD
Definition
(GenBank) Lipoprotein releasing system ATP-binding protein LolD
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa02010  ABC transporters
Module
asa_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:asa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ASA_1884 (lolD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asa02000]
    ASA_1884 (lolD)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     ASA_1884 (lolD)
Transporters [BR:asa02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    ASA_1884 (lolD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_22 PRK cobW FtsK_SpoIIIE NACHT MobB RecA_dep_nuc AAA_30 RsgA_GTPase AAA_33
Motif
Other DBs
NCBI-ProteinID: ABO89959
UniProt: A4SM37
Position
1996494..1997192
Genome map
AA seq 232 aa AA seqDB search
MNEPLSSEPLLRCQALNHVYQEGELEIQVLKGIDLSVAPGEMLAVVGSSGSGKTTLLHLM
GALDNPSSGAVLFKGQDIHHWDSRTQARFRNQELGFVYQFHHLLAEFTALENTAMPLLIA
GESVAVATDKATRMLGRVGLSHRLNHRPSELSGGERQRVAIARALVNEPSLVLADEPTGN
LDHASATAVYELLCELNRELGTAFVVVTHDLSLAAKLHRRVTLVSGIMAEVA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacccttgtctagtgaacctctgctgcgttgtcaggccctgaatcatgtttat
caagagggtgagctggagatccaggttctcaaggggattgatctgagtgtggcccccggc
gagatgctggcggtggtgggcagctcgggatcgggcaagaccaccttgctgcatctgatg
ggggcgctcgacaacccgtcaagcggcgccgtgctgttcaaggggcaggatatccaccac
tgggatagccgtactcaggcgagattccgcaaccaggagctgggatttgtctatcagttt
caccacttgctcgccgagtttaccgcgctggagaacaccgccatgccgctgcttattgct
ggtgagtcggtagccgtcgccaccgacaaggcgactcgcatgctgggtcgggtggggctt
tcccatcgtctcaaccacaggccatccgagctgtccggtggcgaacgccagcgggtggcc
attgcccgcgccctggtcaacgagcccagcctggtactggcggacgagcccaccggcaac
ctggatcacgccagcgccactgctgtttacgagctgctctgtgagctcaatcgtgagctg
ggcactgccttcgtggtagtcacccatgacctgagtctggccgccaagctccatcggcgg
gtcaccctggtgagcggcatcatggcggaggtcgcctga

DBGET integrated database retrieval system