KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1891Help
Entry
ASA_1891          CDS       T00500                                 

Gene name
lon
Definition
(GenBank) ATP-dependent protease La
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asa01002]
    ASA_1891 (lon)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     ASA_1891 (lon)
Peptidases [BR:asa01002]
 Serine Peptidases
  Family S16: lon protease family
   ASA_1891 (lon)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 ChlI AAA_PrkA IstB_IS21 AAA_16 RuvB_N AAA_18 AAA_3 AAA_22 AAA_2 NACHT AAA_14 RsgA_GTPase AAA_33 Bacillus_HBL Phage_GP20 RNA_helicase TsaE T3SSipB
Motif
Other DBs
NCBI-ProteinID: ABO89966
UniProt: A4SM44
Position
2003636..2005990
Genome map
AA seq 784 aa AA seqDB search
MNLERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMEQDKKVLLVAQKDAST
DEPTVEEIFSVGTVANILQMLKLPDGTVKVLVEGGQRARLERIIDDKDFFVGEAQYIAST
AIEEKYQDVLVRSAIGQFEGYIKLNKKIPPEVLTSISAIDDAARLADTMAAHMPLKLEDK
QKVLEIASVSERIEFLMAMMESEIDLLQVEKRIRTRVKKQMEKSQREYYLNEQMKAIQKE
LGELEDSPDEFEALNRKIEEAGMPEDAREKAHAELAKLKMMSPMSAEATVVRSYVDWMVQ
VPWKARSKVKKDLGKAQEVLDSDHFGLEKVKERILEYLAVQARVNKLKGPILCLVGPPGV
GKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLF
LLDEIDKMSSDMRGDPASALLEVLDPEQNNSFNDHYLEVDYDLSDVMFVATSNSMNIPGP
LLDRMEVIRLSGYTEDEKLNIAKQHLVSKQIQRNGLKESEITIEDSALVGVIRYYTREAG
VRNLEREISKICRKAVKRILLDKSIKHVQVNQANLKEFLGVQRFDYGKATDQNQVGQVCG
LAWTEVGGDLLTIETTNMPGKGKLTYTGSLGDVMQESIQAAMTVVRARADKLRINADFYE
KRDIHVHVPEGATPKDGPSAGIAMCTALVSSLTGNPVRADVAMTGEITLRGEVLPIGGLK
EKLLAAHRGGIKRVLIPKENERDLEEIPDNVKQDLEIYPVRWIDEVLELALQDNPQGFER
VSVV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagagcgttcagaacgcatcgagattcccgtcctgcctcttcgtgacgtggtg
gtttacccccacatggtcattccactctttgtggggcgggaaaaatccattcgctgtctg
gaagcggccatggagcaggacaaaaaagttctgctggtggctcagaaggacgcgtcaacc
gatgagccgacggtggaggagattttctccgtcgggacagtggccaatattctacagatg
ctcaagctgccggatggcaccgtcaaggtgctggtggaagggggccagcgtgcccgtctt
gagcggataatcgatgacaaggacttcttcgtcggtgaggcgcagtacatcgcttctacc
gccatcgaggagaagtaccaggacgtgctggtgcgctccgccatcggtcagtttgaaggc
tatatcaagctcaacaagaagatcccgcccgaggtattgacctcgatttcggcgatcgat
gatgctgctcgcctggccgataccatggccgcacacatgccgctcaagctcgaagacaag
cagaaggtgctggaaatcgcctctgtgtccgagcgcatcgagtttctgatggccatgatg
gagtcggagattgacctgctgcaggtcgagaaacgcatccgtacccgggtcaagaagcag
atggagaagagtcagcgggagtactatctcaacgagcagatgaaggccatccagaaagag
ctgggtgagctggaagacagcccggatgaatttgaagccctcaatcgcaagattgaagag
gcggggatgccggaagatgcccgtgaaaaggcccatgccgagctcgccaagctgaagatg
atgtcccccatgtctgccgaagccacagtcgtgcgcagctatgtggactggatggtacag
gtgccgtggaaggcgcgctccaaggtcaagaaagaccttggcaaggcgcaggaggtgctg
gattcggatcactttggtctggagaaggtcaaggagcgcatcctcgagtatctggcggta
caggcgcgggtgaacaagcttaaaggccccatcctctgtctggttggtcctcccggtgtg
ggcaagacctcgctgggccagtccatcgccaaggcaaccggtcgcaagtatgtgcgtatg
gccttgggtggggtgcgtgacgaagcggagatccgtggtcaccgtcgtacctatatcggt
tccatgcccggcaagctcatccagaagatggcgaaggtgggggtgaaaaacccgctgttc
ctgctcgatgaaatcgacaagatgagctcggacatgcgtggcgatcccgcttctgccttg
ctggaagtgctggatccggagcagaacaacagcttcaacgatcactatctggaagtggat
tatgacctgtcggacgtcatgttcgtggccacctccaactccatgaacatcccgggtccg
ctgctggaccggatggaagtgatccgcctctccggttataccgaagatgagaagctcaat
attgccaagcagcatctggtctccaagcagatccagcgcaacggcctgaaagagtccgag
atcaccatcgaagattctgctctggtcggtgtgatccgctactacacccgcgaggcgggg
gtgcggaatctggagcgggagatctccaagatttgtcgcaaggcggtcaagcgcatcctg
ctggacaagagcatcaagcatgttcaggtcaatcaggccaacctcaaggagttcctcggg
gtgcagcgtttcgactacggcaaggccaccgaccagaaccaggtcggtcaggtctgtggt
ttggcgtggaccgaagtgggcggcgatctgctcaccatcgaaaccaccaacatgccgggc
aagggcaagctcacctacaccggttcactcggtgatgtgatgcaggagtccatccaggct
gccatgacggtagtacgggcccgtgccgacaagctgcgcatcaatgccgacttctacgag
aagcgcgatatccatgtgcacgtgccggaaggggcgaccccgaaagacggtccgagtgcc
ggtatcgccatgtgtaccgcgctggtctccagcttgaccggtaatccggttcgtgctgat
gtggccatgacgggggaaatcaccttgcgcggcgaagtgctgcccatcggcggtctcaaa
gagaagctgctggcggctcatcgtggtggcatcaagcgtgtgcttatcccgaaagaaaac
gaacgagacctcgaagagatcccggacaacgtcaaacaagaccttgaaatctatccggtt
cgctggattgatgaagtgctggaactggcgttgcaggacaatccgcaagggtttgagcgc
gtttctgtcgtgtaa

DBGET integrated database retrieval system