KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2159Help
Entry
ASA_2159          CDS       T00500                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00071  Fatty acid degradation
asa00072  Synthesis and degradation of ketone bodies
asa00280  Valine, leucine and isoleucine degradation
asa00310  Lysine degradation
asa00362  Benzoate degradation
asa00380  Tryptophan metabolism
asa00620  Pyruvate metabolism
asa00630  Glyoxylate and dicarboxylate metabolism
asa00640  Propanoate metabolism
asa00650  Butanoate metabolism
asa00900  Terpenoid backbone biosynthesis
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
asa01200  Carbon metabolism
asa01212  Fatty acid metabolism
asa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASA_2159 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ASA_2159 (atoB)
   00640 Propanoate metabolism
    ASA_2159 (atoB)
   00650 Butanoate metabolism
    ASA_2159 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASA_2159 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ASA_2159 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASA_2159 (atoB)
   00310 Lysine degradation
    ASA_2159 (atoB)
   00380 Tryptophan metabolism
    ASA_2159 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASA_2159 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASA_2159 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ASA_2159 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asa04147]
    ASA_2159 (atoB)
Enzymes [BR:asa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ASA_2159 (atoB)
Exosome [BR:asa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASA_2159 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABO90224
UniProt: A4SMV2
Position
complement(2296147..2297151)
Genome map
AA seq 334 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAIAQAGLKGEQIDEAYMGNVLSAGV
GQAPARQAVLKAGLPESVPCTTVNKVCGSGMKAVMLAADSLRLGDTDIVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLARSDMDAFAIA
SLTRALAAQQSGAFKAELAQVTVGDTLLLAEDEQPAKARPDKIPHLKPAFSKQGTITAAN
ASSISDGAAALILMRAETAAQLGLPVLAMAGCNLPHDKVNVNGGACALGHPLGASGARIL
VTLIHALHARSLKRGVASLCIGGGEATAVAIELS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatattgtgattgttgcggccaagcgtacccccatgggggccttccagggagccttg
gccaacctgactgcccccgagcttggcgcttgcgccattgctgccgccatagcacaagcc
gggctcaagggggagcagatcgatgaagcctacatgggcaatgtgctcagtgccggggtg
gggcaggcacccgcccgtcaggctgtgttgaaggcaggtttgccggagagtgtgccatgc
accactgtcaacaaggtgtgtggttccggcatgaaggcggtgatgctggcggcagacagc
ttgcgtctgggtgacaccgacatagtgatcgccggtggcatggagagcatgagccgggcg
ccttacctgctcgacaaggcgcgcagcggttttcgcatggggcatcagagcgtgctggat
catatgttcctcgatggcttgcaggatgcttacgaaggccagttgatggggcattatgcc
cagttgagtgcggatcgcgccggtctggcccgctccgacatggacgcttttgccatcgct
tccctgacgcgtgcgctggctgcccagcagagcggtgctttcaaggccgagctggcccag
gttactgtcggtgacaccctgctgctcgccgaggatgagcagcctgccaaggccaggccc
gacaagatccctcatctgaaaccggcattcagcaagcagggcaccataacggctgccaat
gccagctccatctcggacggagcggcggcgctcatcctgatgcgagccgagacggcggcg
cagctgggcctgcctgtgctggccatggcgggttgcaacctgcctcatgacaaggtgaac
gtgaacggcggggcctgcgcactggggcatccactgggggcgagtggtgcccgtattctg
gttacgctcattcatgcactgcatgcgcgcagtctgaaacggggtgtggcaagcctgtgt
atcggtggaggggaggcgactgccgtcgccatcgagttgagctaa

DBGET integrated database retrieval system