KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2356Help
Entry
ASA_2356          CDS       T00500                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00020  Citrate cycle (TCA cycle)
asa00310  Lysine degradation
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01120  Microbial metabolism in diverse environments
asa01130  Biosynthesis of antibiotics
asa01200  Carbon metabolism
Module
asa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASA_2356 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ASA_2356 (sucB)
Enzymes [BR:asa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ASA_2356 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABO90405
UniProt: A4SND3
Position
complement(2507843..2509027)
Genome map
AA seq 394 aa AA seqDB search
MTIEIKVPDLPESVADATIATWHKKPGDLVARDEVLVDIETDKVVLEVPAPEAGILGDIL
QAEGATVLSRQLIAMLKPAPVAGEETKEKPVEAVADDGADGLSPSVRRLVAEHAIDVAKL
TGTGKGGRVTKEDVEAFIKGGNKPAAAPAAAAPVAAVAPLVGRTEKRVPMTRLRKRIAER
LLEAKNTTAMLTTFNEINMAPIMKLRKQYGEIFEKKHGIKLGFMSFYVKAVVESLKRYPE
VNAGLDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDCDNMSLADIEKAIKDLAGKGRDGKL
TVDELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGKVEILPMMYLA
LSYDHRIVDGRESVGFLVSIKELLEDPTRLLLDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgagatcaaggtaccggacctgccggaatcagtggcggacgccaccatcgcc
acctggcacaagaaaccgggtgatctggttgcccgtgacgaagtactggttgacatcgaa
accgataaagtcgtgctggaagtccccgcgccggaagccggtattctgggtgacatcctg
caagcggaaggggcgaccgtgttgtcccgccagctgatcgccatgctcaagccggctccc
gtggccggtgaagagaccaaagagaagccggtggaagcggttgccgacgacggcgcagat
ggcttgagcccctccgttcgccgtctggtggccgagcacgccatcgacgttgccaaactg
accggcaccggcaagggtggtcgcgtcaccaaggaagacgtggaagccttcatcaagggt
ggcaacaaacctgccgccgcgccggccgcagctgcgcctgtggcagcagtagcaccgctg
gtgggtcgcaccgagaagcgcgtgcccatgactcgtctgcgcaagcgcattgccgagcgt
ctgctggaagccaaaaacaccactgccatgctgaccactttcaacgagatcaacatggcg
cccatcatgaagctgcgcaagcagtacggcgagatcttcgagaagaagcacggcatcaag
ctcggcttcatgtccttctacgtcaaggcggtggtggagtccctgaaacgctatccggaa
gtgaacgccgggctggacggtgacgacatcgtttaccacaactatttcgacgtcagcatc
gccgtttctaccccccgcgggttggtgacccctgtgctgcgcgattgcgacaacatgagc
ctggccgacatcgagaaggccatcaaagacttggctggcaagggccgtgacggcaagctg
accgtggatgaactgactggcggcaacttcaccatcaccaacggtggtgtgtttggctcc
ctgatgtccacccccatcatcaacccgccccaaagcgccatcttgggtatgcacaagatc
caggacagacctatggcggtggacggcaaggtcgagatcctgccgatgatgtacctggcc
ctctcttatgatcaccgcatcgtcgacggtcgcgagtcggtgggcttcctggtctccatc
aaggagctgctggaagacccgacccgtctgttgctggatgtctag

DBGET integrated database retrieval system