KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2457
Entry
ASA_2457          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:asa02044]
    ASA_2457
Secretion system [BR:asa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ASA_2457
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: ABO90497
UniProt: A4SNM5
Position
complement(2615682..2617118)
AA seq 478 aa
MSQNQQGQQALKVGRDPRMLPEYEALRSEINKLSHASRPEVDWLKIHRLASLIFEKHGVD
LQTAIYFTLARSRLQGLNGFTEGCEFLANLIVTQWESFWPPVHQERARIEMLDWFIARIS
DVIRQYQISHEDKRLVYRCERALQLISEKLHNVGLSRIPRVENLVHFIEGYTHLFDETEI
VIVSDEPGLKEELQIPPMVFFKSDMEHDSPSSSAPSSSTPHLPQGSILIGREKGQVKPTV
LKIEQHRKQRPAWFWFGCGLLSCALPVMGWLGWQHQQQEKTVAAQRLQQPAAELPRALSY
DDIRQARIVLGEQTLQGMESELVSRYQAQLGRLEQTSPLYWYRYGEGLRNSLQMLYPDSL
AVKALGKQWQTALAGQQGDVVSVPTYLDARAGVDALLDQLLELERQRKTVTISYLKSQLY
EVQKNLMQDIPFSLRLSELEARKASQEPVTAAELKGLENDLKALNIRLYQLQQSSAGS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcacagaatcaacaaggtcagcaggcgctgaaagtggggcgcgatcctcgcatgttg
ccggaatacgaggcgttgcgcagcgagatcaacaaactcagccacgcctcccgccccgag
gtggactggctcaagatccatcggctcgcgagccttatctttgaaaagcacggggtggac
ctgcagaccgccatctacttcaccctggcgcggtcgcgcctgcaagggctgaacggcttt
accgaagggtgcgagtttctggccaacctgatagtgacccagtgggagagcttctggcca
cctgtgcatcaggagcgagcccgtatcgagatgctggactggttcattgcccgtatcagc
gacgtgatccgccagtaccagatcagccacgaagacaagcgcctcgtctatcgctgcgag
cgggcgctgcaacttatcagcgagaagctgcacaacgtgggcttgagccgtattccccgg
gttgaaaatctggtgcacttcatcgaggggtatacccatctgtttgatgagaccgagatc
gtcatcgtctccgatgagcccggtctcaaggaggagctgcagatcccgcccatggtgttc
ttcaagtccgacatggagcacgacagcccttcttcttcagcgccctcttccagcacgcca
cacctgccccagggcagcatactgattggtcgcgagaaggggcaggtcaaacccacagtg
ctcaaaattgaacagcaccgcaagcagcggcccgcctggttctggtttggctgtggtctg
ctcagctgcgccctgcctgtgatgggctggcttggctggcaacatcagcagcaggagaaa
acagtggctgcccagcgcttgcagcaaccggccgccgagttgccacgggctctcagttat
gacgatatccgccaggcgcgcatcgtactgggcgaacagaccctgcaaggcatggaaagc
gagctggtgtcccgttatcaagcccagctgggacggcttgagcagacctcgccgctctac
tggtatcgctatggggaagggctgcgcaactcgctgcagatgctctatcccgactcgctg
gcggtcaaggcgctgggcaagcagtggcagacggcgttggcaggtcagcagggggatgtg
gtcagcgtaccgacctatctggatgctcgcgccggtgtcgacgccttgctcgatcagctg
ctggagctggagcgtcagcgcaagacggtgaccatctcctatctcaagtcccagctctat
gaggtgcagaaaaacctgatgcaggatatcccgttcagtctgcgcctgagcgaactggag
gcgagaaaggcatcccaggagcccgtcacggcagccgagctgaaaggtctggagaacgac
ctgaaagcactcaatatccgcctctaccagttgcagcagagcagtgcaggcagttga

DBGET integrated database retrieval system