KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2464
Entry
ASA_2464          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:asa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ASA_2464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:asa02044]
    ASA_2464
Secretion system [BR:asa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ASA_2464
SSDB
Motif
Pfam: T6SS-SciN DUF3662
Other DBs
NCBI-ProteinID: ABO90503
UniProt: A4SNN1
Position
complement(2629012..2629527)
AA seq 171 aa
MIRALMLGACLLALAGCTTMGKMADVAMDPDIQVGSNDEQATTLGLSLLAERDVNPNESG
EAAPIEFQVVLLAEDSKLLATDYDQVTEDVEKALGKNYLDHQDYTLLPGQFKYLPPIKLD
EKTRYIGVIARYADPDSAEWRKVIKVKSMGRAYQILVHLRLDEVELQKEEE
NT seq 516 nt   +upstreamnt  +downstreamnt
atgatacgtgcgctgatgctgggggcctgtctgctggccctggcaggctgtaccaccatg
ggcaagatggccgatgtggccatggacccggatatccaggtgggcagcaatgatgaacaa
gccaccaccctggggctgagcctgctggccgagcgggatgtcaatcccaacgagagcggg
gaggcggcacccatcgagttccaggtggtgttgctggccgaagactccaagctgcttgcc
actgattacgaccaggtgaccgaggatgtggagaaggcccttggcaagaactacctggat
catcaggactacacactgctgccgggccagttcaagtatctgccgcccatcaagctcgat
gagaagacccgctacatcggcgtgattgcccgttatgccgatccggacagcgccgagtgg
cgcaaggtcatcaaggtgaagagcatggggcgagcctatcaaatcctggttcatctgcgt
ctggatgaagtagaactgcaaaaagaagaagaataa

DBGET integrated database retrieval system