KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2465Help
Entry
ASA_2465          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:asa02044]
    ASA_2465
Secretion system [BR:asa02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   ASA_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: ABO90504
UniProt: A4SNN2
Position
complement(2629527..2630750)
Genome map
AA seq 407 aa AA seqDB search
MDDFNQQLSLVVLNSEQLDGSQQVQYRFDEMGGTLGASEQDDWQLRDRLGSVMPAHARIE
LNDGRFCLCDLSGQTYINGATSPIGRARKVHLEQGDELIVGPFRMRAYLGAISPEQNLHQ
VLGNRPSEQLDEWLAGEETSQAMEDPRALAVALQHERSVLTPLVDPRQPSPLRSQPDMDA
VSLAPFSAVENTMNQEFLDMPTIENHPDYHPPLEGVDHVALTPLMRGLGQSLQLQDTQQA
HDMLEEMGKTVRAMVEGLLQLQTEQAALADKHLRPIEDNPLRLGLDYDETLAVMFAEQKS
PVHLTAPAAVAESLRNVRIHHVANQQAIGAALDSILQAFSPEALIGRFEHYRRTGAPGVA
DEGWAWNMYQHYYRELTSARQQGFDKLFHQVYAQAYDQAVRQQQGLI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggacgattttaatcagcaactttccctggtggtgctcaacagcgaacagctcgatggc
agccagcaggtgcagtaccgcttcgacgagatggggggcactctgggtgcctcagagcag
gatgattggcaattgcgtgacaggttgggctcggtcatgccagcccacgcccggatcgag
ttgaacgatggccgtttctgcctgtgcgatctgagcggtcagacctacatcaacggcgcg
acctcgcccatagggcgggcccgcaaggtacaccttgagcagggtgacgaactgatcgtc
ggtccgttccggatgcgcgcctatctgggggccatctcccccgagcagaacttgcatcag
gtgctgggcaaccggccctccgagcagctcgatgagtggcttgccggggaggagaccagt
caagccatggaggatccacgcgccctcgccgtggcactgcaacatgaacgctcggtgctg
accccgctggtggatcctcgccagccgtcaccactgcgttcacaaccggatatggatgcc
gtatccctcgcccctttttctgctgtcgagaacaccatgaaccaagaatttctggatatg
cccaccatagagaatcaccccgactaccaccctccgctggagggggtggatcacgtggcg
ctgacccccttgatgcgcggcctgggtcagtccctgcagttgcaggatacccagcaggct
cacgacatgctcgaagagatgggcaaaacggtgcgcgccatggtggaaggactgctgcag
ttgcaaaccgaacaggcggcgctggcagacaagcacctgcgtcccatcgaagacaacccg
ctgcgccttggcctcgactatgacgagaccctggcggtgatgtttgccgagcagaagagt
ccggtgcacctgacggcaccggcggccgtggccgagagcctgcgcaatgtgcgcattcat
catgtggcgaaccagcaggccattggcgcggcgctggacagcatattgcaagccttctcg
ccagaggcactgattggccgtttcgagcactaccgccgtaccggcgcccccggtgtagcc
gacgaaggctgggcctggaacatgtaccagcactactaccgcgagctcacttctgcccgt
cagcaggggttcgacaagctgttccatcaggtctatgcccaggcatacgaccaagccgtg
cgtcagcaacagggactgatttga

DBGET integrated database retrieval system