KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2467
Entry
ASA_2467          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:asa02044]
    ASA_2467
Secretion system [BR:asa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ASA_2467
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABO90506
UniProt: A4SNN4
Position
complement(2631759..2633525)
AA seq 588 aa
MSLEHYFRDELAFLRLQGREFADTYPELTRFLSEQNTDPDVERLLEGFAFLTGNLRAKIE
DEFPELTHGLLNMLWPNYLRPVPSMTIMQFSVIPGAIAQPALVKQGCQLDSLPIDEVTCH
FQTCHDAWVYPADIRHISAQSGNDLSTISLDIALHAPLPLCELQLDKLRFFLGGDSYTAY
ELYFWLANQLSHIELEIDGKRFRQEAKALKSVGFERDDALLPYPNNVYSGYRILQEYFCF
PESFLFFELSGGDWPKQPLPVSEFKLHFCFDRPLPAELKIRPDSFMLNCVPAINLFQHDS
EPVNLNGRQAEYPLKASYRHADSFEIFSVDQVEGWVEGNLGRSRGTPRIYQPFESFQHQI
ERAKHRLALYYRVRVKESVSGDGFEHNLSFVRGDETTTVELDESISVTLTCTNRSRAARL
KAGSICVPTGSSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQV
LRTYDFPALHDKQAEQASRKRLAGIEEIETKPVDRLVRGMPVRGLKSVLSIRQSAFGSEG
ELYLFSTVLAHFFSLYASVNAFHLLEVVNLDNKERYQWPVQIGQHSLM
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcgctggaacattacttcagggatgaattggcttttttgcgcctgcaagggcgcgaa
tttgccgatacctatcccgagctcacccgtttcctgtcggagcaaaataccgatccggat
gtggagcgcctgctggaaggcttcgcgtttctcaccggcaatctgcgcgccaagatcgag
gatgagtttcccgagctgacccatggtctgctcaatatgctctggcccaactatctgcgc
cccgtacccagcatgaccataatgcagttttcggttattccgggtgccatcgctcaaccg
gcgctggtcaagcaggggtgtcagctcgacagcctgcccatcgacgaggtgacctgtcac
tttcagacctgtcacgatgcctgggtctatccggcagatatccgccatatctcggcgcaa
agtggtaacgatctctccaccatctcgctggatattgccctgcatgctcccttgccgctc
tgcgagttgcagctggacaagctgcgtttcttcctcggtggcgatagctataccgcctat
gagctctatttctggctcgccaaccagctctcccacatagagctggagatcgatggcaag
cgctttcgccaggaagccaaggccctgaaatcggtcggtttcgagcgcgacgacgcgctc
ctgccctatccgaacaatgtctattccggctaccggatcttgcaggagtatttctgcttc
ccggaaagcttcctcttctttgaactctcgggcggcgactggccgaagcaacccttgccg
gtgagcgaattcaagctccatttctgtttcgacaggcccttgcctgcggagctcaagatc
cggcccgactccttcatgctcaactgtgtgccggccatcaacctgttccagcacgacagt
gagccggtcaacctcaatggccgtcaggcggaatatcctctcaaggcgagttatcgccat
gcggacagtttcgaaatcttctcggtggatcaggtcgagggctgggtggaaggcaacctg
ggtcgctcccgcggtacgccgcgtatctaccagccgtttgaaagttttcagcaccagatc
gaacgggccaagcacaggttggcactctattaccgggtgcgggtcaaagagtcggtcagc
ggggatggcttcgagcacaacctctcgtttgtacgcggggatgagaccaccacggtcgag
ctggacgaatccatttcggtcacgctgacgtgcaccaaccgctcccgagctgcccgtctc
aaggctggcagcatttgtgtgcccaccggcagctcgccttcctttgccacctttcgcaac
ctgatccggccgacccggccgctgcgtccggcgctggatggcagtctgcactggaccctc
atctccaatctgtcgctcaactatgtctctctgctgcgtcgggatgccctggtgcaagtg
ctgcgcacctatgacttccccgcactccatgacaagcaggcagaacaggcatcgcgcaag
cgactggcggggattgaggagatcgagaccaaaccggtggacaggctggtgcgcggcatg
ccggtgcgcgggctcaagtcggtactctccattcgccaatccgcctttggcagcgaaggg
gagctttatctcttcagcaccgtgctggctcactttttctccctgtatgccagcgtcaat
gccttccacctgctggaggtggtcaatctcgacaacaaggagcgctatcaatggccagtc
cagatcggtcagcactccctgatgtga

DBGET integrated database retrieval system