KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2470
Entry
ASA_2470          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:asa02044]
    ASA_2470
Secretion system [BR:asa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ASA_2470
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABO90508
UniProt: A4SNN6
Position
complement(2635484..2635987)
AA seq 167 aa
MGKGIDGATVAPKERINIKYVPATGGQQAEIELPLTMMVVGNMKGRTEETPIEERQTVSI
DKNNFSSVMKESALELKFSVPNRLEENSQDEMPVSIKIQSLEDFTPDSVAQQVPELRKLL
ELREALVALKGPLGNIPSFRNRLQDLLSSDEAREQLLKELDLIKPAE
NT seq 504 nt   +upstreamnt  +downstreamnt
atgggaaaaggaattgatggtgccactgttgcgcccaaagaacgtatcaatatcaaatat
gtaccggcaacgggtggtcagcaggcggaaatagagcttccgttgaccatgatggtcgtc
ggaaatatgaaggggcgtactgaagaaacgcctatcgaggaacgtcagaccgtctccatc
gacaagaataatttctcttctgtcatgaaagaatccgcactggaactgaagttttccgtt
cccaatcgcctggaggagaacagccaggacgagatgccggtttcgatcaagatccagtct
ctggaagacttcacacctgacagcgtggcccagcaggtacccgagctgcgcaagctgctg
gaactgcgtgaggccttggttgccctgaagggaccgctgggaaatattccctccttccgc
aatcgtttgcaggacctgctgtccagtgatgaggctcgtgagcaactgctcaaggagctg
gatttgattaagcctgccgagtga

DBGET integrated database retrieval system