KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3154Help
Entry
ASA_3154          CDS       T00500                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00900  Terpenoid backbone biosynthesis
asa01100  Metabolic pathways
asa01110  Biosynthesis of secondary metabolites
asa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASA_3154 (dxr)
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ASA_3154 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABO91148
UniProt: A4SQH6
Position
complement(3416830..3418023)
Genome map
AA seq 397 aa AA seqDB search
MHNLVILGASGSIGQSTLKVLRRNPGRWQVLALTAARSVDAMVRDCLEFSPRFAVMVDEA
AATALAGQLKTHGSATRVLSGQAALCEVAAHPDAHSVMAAIVGAAGLAPTMAAVRAGKRI
LLANKEALVMSGAFFMEAVREHGAELLPIDSEHNAIFQCLPEAIQRQPGYCDLAGAGISR
ILLTGSGGPFRYTDINALAQVTPAQAIAHPNWSMGAKISVDSATMINKGLEYIEARWLFN
AAPEQIQVVIHPQSVIHSMVQYKDGSVMAQLGNPDMCTPIAHALAYPARVESGVEPLDFF
SVGEFSFIRPDYERYPCLALAMSACQQGQAATTALNAANEEAVAAFLAERIGFMDIARVN
EATMVALGSSPVGSLDDLIALDGAARARAHNLIEELS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcataacctggtgatcctgggggcttccggctccatcgggcagagcaccctcaaggtg
ctgcgccgcaatcccgggcgctggcaagtactggcgctcaccgccgctcgcagcgtggat
gccatggtgcgggactgtctcgagttttccccccgtttcgccgttatggtggatgaggct
gccgcgaccgcactggcgggccagctcaagacccacggtagcgcgacgcgggtactgtcc
ggtcaggctgccctgtgcgaggtggcggctcaccccgatgcacacagcgtgatggcggcc
atcgtcggtgcggcgggtctggcaccgaccatggccgcagtgcgtgccggcaagcggatc
ctgctggccaacaaggaggcgctggtgatgtccggggccttcttcatggaggcggtgcgc
gagcatggcgccgagctgctgcccatcgacagcgaacacaatgcgatttttcagtgcctg
cccgaagccattcagcgccagcccggctactgcgatctggcaggggcgggcatcagcagg
atactgctgaccggctcaggcggtccgtttcgttataccgatatcaatgcgctggcacag
gtcacgccggcccaggccatcgcccacccgaactggtccatgggggccaagatctcggtc
gactccgccaccatgatcaacaaggggctggagtacatagaggcgcgctggctgttcaac
gccgcgcccgagcagatccaggtggtgatccatccccagtcagtgatccactccatggtg
cagtacaaggacggctcagtgatggcccagcttggcaatccggacatgtgtacccccata
gcgcacgccctggcctatccggctcgagttgagtccggagtggaacctttggatttcttc
agtgtcggagagttcagctttatccggcccgattatgagcgttatccctgcctggcactg
gccatgagtgcctgtcagcaagggcaggcggcgaccacggcgctcaatgctgccaatgaa
gaggccgttgcggctttccttgcagagcggatcggttttatggatattgccagagtcaat
gaggccaccatggtggcgctggggagttcccctgtgggttcgctggatgatttgattgcg
ctggatggtgcggcccgtgcccgtgctcacaatttgattgaggagcttagctaa

DBGET integrated database retrieval system