KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3170Help
Entry
ASA_3170          CDS       T00500                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asa03016]
    ASA_3170 (truC)
Enzymes [BR:asa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ASA_3170 (truC)
Transfer RNA biogenesis [BR:asa03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ASA_3170 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABO91163
UniProt: A4SQJ1
Position
complement(3433930..3434670)
Genome map
AA seq 246 aa AA seqDB search
MKLTLLYQDDWLVAVNKPSGLLVHRSWLDKAETRFAMQMTRDLIGGRHVYPVHRLDRPTS
GVLLFALDPAVARILTEAFAARQVHKEYLALVRGWAPEQGVIDYPLKEQLDKIADAMSNP
DRPAQEAVTAFRCLHQVELPHAVSKKHPTSRYSLVKLFPKTGRKHQLRRHMEHLFHPIVG
DTTHGDGRHNRFFREHFGCERLLLVARTLSFEHPILKVPMRIQAPLGLDLLQLFAELGWP
GSESDY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactctgctctatcaggatgattggttggtagcggtcaacaaaccctccggt
ctgctggtgcaccgcagctggctcgacaaggccgagacccggttcgccatgcagatgacc
cgggatctgatcggggggcgtcatgtctaccccgtgcatcgcctcgatcgccccacctcg
ggcgtgctgctgtttgctctggatcctgccgttgcccgtatcctgacagaggcctttgcc
gcccggcaggtacacaaggagtatctggcgctggtgcggggctgggccccggagcaggga
gtgatcgactaccccctcaaggagcagctggacaagatcgccgatgccatgagcaatcct
gatcgcccggcccaggaggcggtaacggcatttcgttgcctgcatcaggtcgaactgcct
catgcggtttccaagaagcaccccaccagtcgctatagtctggtcaagttgttcccgaaa
accggtcgcaagcatcagttgcgccgccatatggaacatcttttccacccaatagtgggc
gataccactcatggtgatggtcgccacaatcgcttctttcgtgaacacttcggctgcgaa
cgcctgctgctggtagctcgtactctcagcttcgagcacccgatcctcaaggtcccgatg
cggatccaggcgccgctgggccttgatctattgcagctgttcgccgagctgggctggcct
ggcagtgaaagtgactactga

DBGET integrated database retrieval system