KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3756Help
Entry
ASA_3756          CDS       T00500                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00051  Fructose and mannose metabolism
asa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ASA_3756 (mtlD)
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ASA_3756 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA Sacchrp_dh_NADP F420_oxidored 3HCDH_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABO91717
UniProt: A4SS45
Position
complement(4046212..4047357)
Genome map
AA seq 381 aa AA seqDB search
MKTLHFGAGNIGRGFIGKLLADASHQVTFADVNETLIDQLNHRQEYKVHVVGADQKLDVV
RNVAAVSSAGHEVIARIITADLVTTAVGPNILDKIASTLAKGLQARFDAGNLSPLNVIAC
ENMVRGTSHLKQEVLKYLPVAYHATHESCVGFVDSAVDRIVPPAAANDDPLEVTVESFSE
WIVDQTQFKGELPQVAGMEPTDNLMAFVERKLFTLNTGHIVTAYLGKLRGYRTIREAIED
PVIRSKVRRAMEESGAVLVKRYGFDPRLHAAYIEKILARFANPYLVDEIDRVGRQPLRKL
AAGDRLVKPLLGTLEYGLPSDHLQEGIAAALHYCNADDPQAVELQALLAELGPAQALARV
TGLAADSDIVSAIVARYDSLK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattgcattttggtgccggcaatatcggtcgtggcttcatcggaaaactgctg
gccgacgccagccatcaggtcaccttcgccgacgtcaacgagaccctgatcgatcagctc
aaccaccgtcaggagtacaaggtgcacgtggtgggggcggatcagaagctggacgtggta
cgcaacgtggcggcggtcagctccgccggacacgaggtgatagcccgtatcatcaccgcc
gatctggtcaccacggcggtcggccccaacattctggacaagattgccagcaccctggcc
aaggggcttcaggcccgtttcgatgccggcaacctgagcccgctcaacgtcatcgcctgc
gagaatatggtgcgcggcaccagccatctcaagcaggaggtactcaagtacctgccggtc
gcgtatcatgccacgcacgaatcctgcgtcggcttcgtcgactcggcggtggatcgcata
gtgccaccggcggcggccaacgacgatccgctggaagtgacggtggagagcttcagcgag
tggatcgtcgaccagacccagttcaagggcgaactaccccaggtggcgggcatggagccc
accgacaacctgatggccttcgtcgagcgcaagctgttcaccctcaacaccggccatatc
gtcaccgcttacctcggcaagttgcggggctaccgcaccattcgtgaggcgatcgaggat
ccggtgatccgcagcaaggtgcgccgcgccatggaggagagcggagccgtgctggtgaaa
cgctacggcttcgatccccgactgcacgccgcctacatagagaagatcctggcccgcttc
gccaacccctatctggtggacgaaattgaccgggtcggccgtcagccgctgcgcaaactg
gcggcaggggatcggctggtgaagccgctgctcggcaccctagagtacggcctgcccagc
gaccatctgcaagagggaatcgcagcggcgctgcactattgcaacgccgatgacccccag
gcggtggagctgcaggccctgctggcggaacttgggccggcccaggccttggcccgggtg
accggccttgccgccgacagcgatattgtcagtgccatcgtcgcccgttacgacagcttg
aagtga

DBGET integrated database retrieval system