KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_3764Help
Entry
ASA_3764          CDS       T00500                                 

Gene name
yggA
Definition
(GenBank) putative amino acid transporter yggA
  KO
K06895  L-lysine exporter family protein LysE/ArgO
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asa02000]
    ASA_3764 (yggA)
Transporters [BR:asa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ASA_3764 (yggA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE
Motif
Other DBs
NCBI-ProteinID: ABO91725
UniProt: A4SS53
Position
4056799..4057419
Genome map
AA seq 206 aa AA seqDB search
MFATTLQGFTLGLAMIIPIGAQNAFVLSRGIHRNHHLLAATLCCLCDLILIGIGVFGGAN
LLAASPIGLALLTWGGVLFLCWFGIRSLRSAWQGQGAALADSPRLMGVKSVLAMTLGVTL
LNPHVYLDTLMLLGSFGSQFAEPLRPAFAAGAMLASLVWFYSLAFGAAALSPWLARGRVQ
QAIDTIVGLIMLGLALQLASGALLAS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgaccactctgcaaggcttcacccttggccttgccatgatcattcccatcggt
gcccagaacgctttcgtgttgagccggggcatacatcgcaatcaccatctgctggctgcg
accctctgctgtctgtgtgatctcatcctgatcgggattggggtattcggcggggccaac
ctgctggcagccagtcccatcgggctggcgctgctgacctggggtggtgtgctgtttctt
tgctggttcggcattcgctccctgcgcagtgcctggcaagggcagggggctgcgctggcg
gattcaccccggctgatgggggtcaagagcgtgctggccatgacgctcggggtgaccctg
ctcaatcctcacgtctatctggataccctgatgctgctcggctcctttggcagccagttt
gccgaaccgttgcgcccggcctttgcggccggggccatgctggcttccctggtctggttc
tacagtctcgcctttggtgcggccgcgctctcaccctggcttgcacggggccgggtgcag
caagctattgatactattgttggtttaatcatgttgggactggcattgcaactggcgagc
ggggccttgctggcctcataa

DBGET integrated database retrieval system