KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_4082Help
Entry
ASA_4082          CDS       T00500                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:asa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ASA_4082 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:asa03011]
    ASA_4082 (rplV)
Ribosome [BR:asa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ASA_4082 (rplV)
  Bacteria
    ASA_4082 (rplV)
  Archaea
    ASA_4082 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABO92023
UniProt: A4ST01
Position
complement(4374931..4375275)
Genome map
AA seq 114 aa AA seqDB search
MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAAVLVKKVLESAIANAEH
NEGADIDALRVATIMVDEGPSMKRIRPRAKGRADRILKRTAHITVVVSDAKAGR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcgctaaacaccgttatgcccgtacttctgcccagaaagctcgtctggta
gccgatcaagtacgtggtctgtctgtagacaaggctctgaatatcctgaccttcagcccg
aaaaaggctgcagtgctggttaagaaagtgctggaatctgccattgcaaacgctgagcac
aacgaaggcgctgatatcgatgcgctgcgtgttgctactatcatggtcgacgaaggtccc
tccatgaagcgcatccgtccgcgtgccaaaggtcgtgcggatcgtatcctcaagcgtacc
gctcacatcactgtagtggtatccgacgctaaggctgggagataa

DBGET integrated database retrieval system