KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_P5G128
Entry
ASA_P5G128        CDS       T00500                                 

Gene name
traI
Definition
(GenBank) TraI protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB
Motif
Pfam: TrwC AAA_30 TraI_2B TraI ssDNA_TraI_N AAA_19 AAA_22 NB-ARC
Other DBs
NCBI-ProteinID: ABO92597
UniProt: A4SUM5
Position
p5:121325..126442
AA seq 1705 aa
MLSLGSSAYYAAEENYYAMGDLESVWMGEGADRLGLSGPIDGATLDAIAQGKLPDGTELS
RIVDGKQTHRTGYDLTFSAPKSVSVMALVAGDERFLAAHHHAVAVAMKEVEALASTRIMT
DGITRTETTGNIVAALYTHDTSRELDPQLHTHSLVLNATYAEGKWRALSSDAAHMNSGFG
KDIFNNKLALGQIYRHALRQDVEAMGFETEVTGKHGLWELKGVPTEPFSQRSQQINDAVG
PDASPQSRDAAALDTRKDKAVADPDLLIADWRDRLGKAGFELPLYLAKADERAQGYTVPT
PAGTDITQAVSQAISILSDKKVQFSYSELLAATVSQLPVEQGLITQAREGIEQAIGRERL
IPLDKEKGIFTSDIHLLNELSIAQLANEFNKRPPIATFAERATPRDRPYANAYSVLAQDK
APLAILSGRGGMAQTIERMEDAVLMASEQGREVTILASDNRSARLLAQSQPLAGNIAPRH
TLNAATVFAPHSTLIVEQAESLTLKETLLILEKARASDVQVLMLDSERQRGVGNALSVLK
QASVPQYRFYDAPNIEATVQSVPDKPARFDALAQDYAHRLQQGEQVVAQVSGTRDQQQLT
SHIRSALRDIGQLHGQDHTLNVLAPVWLDSKTRHQRDTYREGMVMERWDDKGKTMDRYRI
DLVADKTHSLVLANEQGEKHTIKIRALDSNWSLFESKRIEVAAGDTLRVLGREAEGTLKA
QQTLQVLDAAPGHLHLKTPTGELQLPTDRALKLDHNYVTGVGVTASQEATVLAAMSARQM
SGTGLNQLARSGQHIHIYTPLDQMRAQSKLASHPQFQLASEKLKAHGDSDQLDTTLKQAT
ASLHTAAEQALHLGLAQVEAKGIVFSTSSLLAAALDFAPATPIDSISAVLDDKLAKGDLL
PVPGKRGDVVSRASFDMEKFIIATIAQGKGTATPYLQQVPDPQLAGLTPGQAQSTRLILE
SNDQFIAIQGYAGVGKTTQFKAVLSALDTLPPEQRPTVVGIGPTHRAVHEMQSTGVKAQT
LASFLSESRLQAMAGEQQDHSRTLFLVDESSMIGNRDMAEFYQRVAASGARVVSSGDTAQ
LKAISSGAPFQLMQERSAVDVAVMKEIVRQRPELKPAIYSLIDGNLTQSLAQREAVQPAV
VPRDPANKPDAWTPDRSVIEAKNPAELVVKDYVSRTRLTRDNTMVIVHLNEVRHGINAAI
HQALFDKGELGPRQTSLTILDPVRIEENSLRSSEQVQKNALLGKVAVLNQHYYTISGIDP
QAGTMTIKDNEGKVRLISNIENTAHDLAIYQPREIKVSEGDKIRFTRTVNEHGHVANSQW
QVKRIEDNGAIVLHDGNNEKTVRPDQFKEDQHIDLGYAITAYGAQGASSTYAIELQAIKV
VNRNLITLSSAYVPASRAKEHMQTYTDDKEGWINLLNKNLKSQVSTAHDALEGDQIKGQK
VADMLLGTASTMRSTALGRHVLKTHQLDEQQHMGKYIAPGKKYPTPHAAFPVWDNNGKPA
GAAMVELQSHHQNKGPTLDSEYRLVANERAEFIGLQRASNGETRIATSLVDGIIMAAKHP
QSGILVSINGAPPPFNVNRMTGGKLVVSDTDAQHLQKESERELPLPQDMTTKESKRQDEL
IKTVAREKEHPDIKLPDDKQHAVNRDDKRLHNDINQLNKDAELSERQLRKLAEIGEVAKA
KFTHELHDKLDKLEREIIKELTKGE
NT seq 5118 nt   +upstreamnt  +downstreamnt
atgctgtcactgggcagctcggcctactacgctgccgaggaaaactactacgccatgggc
gatctcgagtcggtctggatgggggaaggggctgaccgccttggactgagtggccccatt
gacggggccaccctcgatgccatcgcccagggcaaactccccgatggcacggaactctcg
cgcatcgtggatggcaagcagacccaccgcaccggctatgacctgacgttttcggccccc
aagagtgtctccgtgatggcactggtggcgggtgacgagcgctttctggccgcccaccat
cacgctgtggcggtggcaatgaaggaggtcgaggcgctggccagcacccgcatcatgacc
gatggcatcacccgcaccgagaccaccggcaatatcgtggcggccctctacacccacgac
acctcccgcgaacttgatccgcagctgcacacccactcactggtgctcaatgccacctat
gcagaaggcaaatggcgggcgctgagcagtgatgccgcccacatgaacagcggctttggc
aaagacatctttaacaacaaactggcgctcgggcagatataccgccacgccctgcgccag
gacgtcgaggcgatgggttttgaaacagaggtcaccggcaagcatggcctgtgggagctc
aagggggtgccgaccgaaccattcagccaacgcagccagcagataaacgacgcggtcggc
cccgatgcctcaccccagtcccgcgatgccgccgcgctcgatacccgcaaggacaaggcg
gttgccgaccccgatctactgatcgccgattggcgtgatcgcctgggcaaagcaggcttt
gaactgcccctctatctcgccaaggccgacgaacgcgcccagggatacaccgtccccacg
ccagctggcacggatatcacccaagccgtgagccaggcgatatccatactttcggataaa
aaggtacagttctcctactccgaattactggccgccacggtgagccagctccccgtcgaa
caggggttgatcacccaggcccgcgagggtatcgagcaggcgattggacgcgagcgcctc
atcccgctcgacaaggaaaaagggatcttcacctccgatatccatctgctcaacgaattg
tccatcgcccagctggccaacgagttcaacaagcgccccccgatagccacctttgccgag
cgggcaaccccgcgtgatcgtccctatgccaacgcctactccgtgttggcccaggacaag
gccccgctggctatcctgtccggacggggtggcatggcccaaaccatcgagcgcatggaa
gatgccgtgctcatggccagcgaacaggggcgtgaggtcaccatcctggccagcgacaat
cgctcggctcgcctgctggcacaaagccagcctctggcaggcaatattgccccgcgtcac
accctcaatgccgccacggtctttgcccctcatagcaccctcattgtcgagcaggctgaa
tccctgaccctcaaagaaacgctgctcatcctggaaaaggcacgggccagcgatgtccag
gtactgatgctcgacagtgagcgccagcgcggcgtcggcaatgcgctctccgtcctcaag
caagccagcgtgccgcagtaccgtttctatgatgcgcccaacatcgaggccaccgtccag
agcgtgcctgacaagccagcgcgttttgacgccctggcacaggactacgcgcatcgtctg
cagcaaggcgagcaggtggttgcccaggtctccgggacacgggatcagcagcagctaacc
agccatatccgcagcgccttgcgggatatcggccaactgcacgggcaggatcacaccctc
aacgtccttgccccggtatggctcgatagcaagacccgccatcagcgtgacacctatcgc
gaggggatggtcatggagcggtgggacgacaagggtaaaaccatggatcgctatcgcatt
gatctcgtcgcagacaagacccactcgctggtgctggccaacgagcagggggagaaacac
accatcaagatccgcgccctggacagcaactggtcgctgtttgaaagcaagcgcatcgag
gtcgcggcgggcgacacactccgggtgctcgggcgagaggccgagggcaccctcaaggcg
caacagaccctgcaggtactggacgcggcccctggccacctgcacctcaagaccccgacc
ggtgagctgcaactgccaacagacagggcactcaagctcgaccacaactatgttaccggc
gtgggcgtcaccgccagccaggaggccaccgtactggccgccatgagtgcccgccagatg
agtggcacagggcttaaccaactggccagaagtggccagcatattcacatctacaccccg
cttgatcagatgcgggcacagagcaagttagccagtcatccccagttccagctggccagt
gaaaagctcaaagcccacggcgacagcgaccagctcgatactacgctcaagcaggccacc
gccagcctgcacacagcggctgagcaagccctgcatttggggctggcccaggtggaagcc
aaaggcatcgtcttttccacctcaagcttgctggccgccgccctggattttgccccggca
accccgattgactcaatcagcgccgtgctcgatgacaaactcgccaagggtgacctgctg
ccggtgcccggcaagcgcggcgacgtggtctctcgagccagctttgacatggaaaagttc
attatcgccaccattgcccaaggcaagggaaccgcgaccccctacctgcagcaggtaccc
gacccccaactggcagggctaacccctggccaggcacaatccactcgcctgatcctggag
agcaacgaccagttcatcgccatccagggctatgccggtgtgggtaaaaccacccagttc
aaggctgtgctgagtgcactcgacaccctgcccccggaacagcgcccgaccgtggtcggg
attggccccacccaccgggccgtccatgaaatgcagtccaccggggtcaaggcacagacg
ctggcctcgtttctctcggagagtcgcctgcaggccatggcaggggagcagcaggaccac
agccgcaccctgttcctggtggatgaaagctcgatgattggcaaccgcgacatggcggag
ttttaccagcgggtggccgccagtggcgcaagggtggtcagcagcggtgataccgcgcag
ctcaaagccatctcgtcaggtgccccgttccaactgatgcaagagcgcagcgcggtcgat
gtggctgtcatgaaagagattgtccgccagcgcccggagctcaaaccggcgatctacagc
ttgatagatggcaacctcacccagtcactggcacagcgcgaagcggtgcaaccggctgtg
gtaccccgagacccggcaaacaaaccggatgcctggacaccggatcgctcggtgattgag
gcaaagaaccccgccgaactggtggtcaaagattatgtcagccgcacccgtcttacacgg
gataacaccatggtgatcgtgcatctcaatgaggtgcgccacggtattaacgccgcaata
caccaggcactgtttgataaaggggaattaggtccacgccagaccagcctgaccattctt
gatccggtgcgcattgaagaaaatagcctgcgtagcagtgagcaggtacagaaaaatgcg
ctccttggtaaagtggccgtgcttaaccagcactattacaccatcagtggtatcgacccc
caggccgggacaatgaccatcaaggataatgagggcaaggtgcgactcatctccaatatc
gaaaacaccgcccatgatctcgctatctatcaaccgagggaaataaaggtcagtgaaggc
gataagatccgcttcacccgcaccgtcaatgaacacggccatgtagccaatagccagtgg
caggtaaaacgcatcgaggataatggcgcgatagtgctgcacgatggcaataacgagaaa
accgttcgccccgaccaatttaaagaagaccagcacattgatttgggatatgccattacc
gcctatggtgcgcaaggggcgagcagtacttacgccatcgaattacaggcgatcaaagtc
gtaaatagaaacttgattaccctgtcgtctgcgtatgtccccgcctcacgtgccaaagaa
catatgcagacctataccgatgataaggaaggctggattaacttgctcaataaaaacctc
aagagccaggttagtaccgcccacgatgcgctcgaaggagaccagattaaagggcaaaag
gtcgcagatatgttattgggtaccgcctcgacgatgcgctctaccgcattaggacggcat
gtgctgaagacccatcaactcgatgagcagcagcatatgggaaaatacattgcaccaggc
aaaaaatacccgaccccgcacgctgcctttccggtgtgggataataatggtaaaccggca
ggggctgccatggtggagctgcaaagccatcaccaaaataaaggccctaccctggacagt
gaatatcgactggtggcaaatgaacgagccgagtttatcggactccagcgtgccagtaat
ggcgaaacccgtatcgccaccagtttggttgatggaattatcatggcagccaagcatcca
caaagtggaatattggtcagcattaacggcgcaccaccaccatttaatgtcaatcggatg
accgggggtaaattggttgtgtcggacacggatgcgcagcacctgcaaaaagagtcagag
cgtgagttaccactgccacaagatatgaccaccaaagaatccaaacgccaggacgagctg
ataaaaacagtggccagggaaaaagaacacccggatatcaaactgcctgatgataaacag
catgcggtcaatcgcgacgacaagcgactccacaacgatatcaatcaactcaataaagac
gcggagttaagtgagcgacaattgcgtaagttggcagaaatcggagaagtggccaaagcc
aaatttacccatgaactccacgacaaactggataagctggaaagggagatcatcaaggaa
ttgaccaagggggagtaa

DBGET integrated database retrieval system