KEGG   Athalassotoga saccharophila: ATHSA_0993
Entry
ATHSA_0993        CDS       T06407                                 

Definition
(GenBank) D-ornithine 4,5-aminomutase subunit beta
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
asac  Athalassotoga saccharophila
Pathway
asac00472  D-Arginine and D-ornithine metabolism
asac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ATHSA_0993
Enzymes [BR:asac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     ATHSA_0993
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: BBJ28091
Position
complement(975129..977300)
AA seq 723 aa
MDVNNKIDINEILKDLEHYRPKRRGWTWRKPYYGKMDGYEYRQISEPLKNSIPLPAAHYF
DNIDPQPDLVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHIDGLMEGTPEGI
GGIPITRKQLRATRKALDMIEEEVGRPINLHSYVSGVAGPEIAVLFAEEGVNGAHQDPQY
NVLYRGINPVRSFVDAAVAKRIMAWANMLQIDGAHNANASARVSWKVMPELLVQHGINSL
YSVKVGMKPENIALSTVPPTAAPTPTMRINLPYAVAVRELFKGYRFRAQMNTKYIESDLF
DATRMHMIDAFITRLTGAHLQSTITPDEGRNVPWHINSIRGVETAKHALIALDGLTEYVK
IDREKINEKVRELKMRAILMLEEIIEVGGYFEAVERGFFVDNGYYPERIGDGIKRKKDGE
IAAGTVVPRDKDYMAPVCEHFGYNNLPSGIEKPCDLIGGCTLCKPEKIKYIDELDESDNV
NLRLQKIEKDEIRPEVEWLNDGVVQIDMTFPTSPDLAEAAAIETAKKFGLTDINVIHKTV
LHPAEGTYVEIKGRVPFSIKIKDIKLPEKIDQLPDEEIIDFFKRYPVSVVAGTVGNDEHS
VGLREILDIKHGGIEKYGIKYIYLGTSVPVEKLIDAAVETNSVAVLASMIITHNDVHIHN
MKKLNDLSIEKGVRDKLILVAGGTQITNDLAKSAGMDAGFGRGTHGADVASFLVRELRRR
GYR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggacgttaacaataagatagacataaatgaaatactcaaagatctcgaacattacaga
ccaaaaagacgtggatggacctggaggaagccgtactatgggaagatggatggatacgaa
tacagacagataagcgaacctttgaaaaattctatcccacttcccgccgcacattatttt
gacaacatagatcctcaacccgatcttgtcataacgagtgagatagcatctggaagattt
gaagatgatataagaaggatgagaatggccgcctggcatggagccgatcacataatggtt
ataagaactcttgggcaatcgcacatagacggtcttatggaaggaacacccgaaggaata
ggcgggataccaataacgagaaaacaattgagggcaactcgaaaggctctcgacatgata
gaggaagaagttggcagacctataaatctccattcctacgttagcggtgtagcaggtcca
gaaatagccgttctttttgcggaagaaggagtcaatggtgcgcatcaggatccacaatac
aacgttctgtacaggggaataaaccccgtgagatcttttgtcgatgcggcagttgcaaaa
cgcataatggcatgggcaaatatgcttcagatagacggggcccataacgcaaatgcctcg
gcaagggtatcgtggaaggttatgccagaattactcgtccagcacggtataaattcactt
tattcggtcaaagtgggaatgaagcctgagaatatagcgctatctacggttccgccaacg
gcagcgccaacgccaaccatgagaataaatttgccttatgccgttgccgtcagagaactc
tttaaaggctacagatttcgtgcccagatgaatacaaagtacatagaatcggatctcttc
gacgcaacgagaatgcacatgatagacgcattcataacaaggctaacgggtgcccatctt
cagtctactataacgccagacgagggaagaaatgtgccatggcacataaactcgatccgc
ggggttgagactgccaagcatgcccttatagccttggatggacttacagagtacgtcaaa
atagacagagaaaaaataaatgaaaaggtaagagaattaaagatgagggcaattctcatg
ctcgaggaaataatagaggttggagggtattttgaagccgtggaaaggggatttttcgtt
gacaatggttattatcccgaaagaattggggatgggataaaaagaaagaaagatggagag
atcgcggccggcacagtagtgcccagagacaaagattacatggcgcctgtctgcgaacat
tttggatataacaaccttccatccggaatagagaagccatgtgatttgataggcggatgc
acactttgtaaaccagaaaagataaaatacatagatgaactcgatgaaagtgacaatgtc
aatttgagattacaaaaaatcgaaaaagacgaaataaggccggaagttgagtggttgaat
gatggcgttgtgcagatcgacatgacctttccaacctctccagaccttgcagaagccgcg
gcaatagaaacggcgaaaaagtttggccttacagatataaatgtgatccataagaccgtc
cttcatcccgccgaagggacctatgttgagataaaaggaagagtcccattctcgataaaa
attaaggatattaaattgccagagaagatagatcaattaccggatgaagagataatagac
tttttcaaaagatatccggttagcgttgtggcaggtactgtgggtaacgacgaacattct
gttgggttgagagagatactcgatataaaacatggaggaatagaaaaatatggcataaag
tacatctatcttgggacaagtgtgcccgtcgaaaagttaatagatgccgcagtcgaaacg
aactctgtggctgtcttagcatcgatgataataacacacaacgatgtgcatatccacaac
atgaagaaattgaacgatctttcaatagaaaaaggtgtaagggataaacttattttagtt
gctggaggtacacagataacaaatgatcttgcgaaatcggccggcatggacgctgggttt
ggaaggggaacacatggtgcagacgtcgcgagtttccttgtaagagaactcagaaggcga
gggtatcgttga

DBGET integrated database retrieval system