KEGG   Aerococcus sanguinicola: AWM72_02110Help
Entry
AWM72_02110       CDS       T04253                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asan  Aerococcus sanguinicola
Pathway
asan00010  Glycolysis / Gluconeogenesis
asan00020  Citrate cycle (TCA cycle)
asan00620  Pyruvate metabolism
asan01100  Metabolic pathways
asan01110  Biosynthesis of secondary metabolites
asan01120  Microbial metabolism in diverse environments
asan01130  Biosynthesis of antibiotics
asan01200  Carbon metabolism
Module
asan_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWM72_02110
   00020 Citrate cycle (TCA cycle)
    AWM72_02110
   00620 Pyruvate metabolism
    AWM72_02110
Enzymes [BR:asan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWM72_02110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H HlyD_D23 RnfC_N DUF2118 RP-C_C
Motif
Other DBs
NCBI-ProteinID: AMB93629
UniProt: A0A0X8FA85
Position
complement(460894..462546)
Genome map
AA seq 550 aa AA seqDB search
MAYIFNMPDVGEGMAEGEIVAWDVKVGDEVQEEDTLVEIQNDKSVEEITSPVTGKVTKLY
YEEGDLAMVGEPLIAFEGEGLEDNEAEAAPASTPESPAQEEKAEDPASSNKGGGSYYKFR
LPDVGEGMAEGEIVSWLVSEGDEITEEDSLVEIQNDKSVEEVASPVAGTVKKILVEAGTI
ANVGDVLAEIDSPEHNGEDDGAEDTSTPSQPAQEAKADEGNDDATGGAASAPATADPNRV
IQAMPSVRKYARDKGVDISLVNGTGKNGQITRDDIDNFDPNAQAASSQEASQEAAPAKEE
KAAKKSPAPAPTVSNEDLVERVKISPMRRIISESMTTSKFTAPQVSLFMDVEVSKLWDHR
KKFKGIAAERDVKLTFLPYVVKALVAAVKKYPMLNASIDEENREYILKKYYNVGIATDTD
NGLFVPNIKNANQKSMFEIANEINEKAAKAHAGELTNEEMGDGTITISNIGSAGGEFFTP
ILNFPEVAILGFGAIKQEPVVNDEGELAVGRVLKLSLTFDHRIVDGAVGQRCLNEVARLL
SEPELLLMEG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcttatatttttaatatgcccgatgtcggcgaaggtatggcagaaggcgaaatcgtt
gcatgggacgtcaaagtcggcgacgaagttcaagaagaagatacactcgtagaaatccaa
aatgataaatctgttgaagaaattacttctcctgttacagggaaagtaaccaagctttac
tatgaagaaggcgacttggcaatggtcggcgaaccattgatcgcattcgaaggggaaggc
ttagaagataacgaagcagaagctgctccagcttcaaccccagaatccccagcccaagaa
gaaaaagctgaagacccagcttcatccaacaagggtggcggctcctactacaaattccgc
ttaccagacgttggtgaagggatggcagaaggtgaaatcgtttcttggttagtttctgaa
ggcgacgaaatcactgaagaagactccctcgttgaaatccaaaacgacaagtctgttgaa
gaagtagcttcaccagttgctggtacggttaagaagatcttagttgaagcaggcaccatc
gctaatgttggggatgttttagctgaaatcgactcaccagaacacaatggcgaagatgat
ggggcagaagatacctcaacgccttcacaacctgctcaagaagctaaggctgacgaaggt
aatgatgacgcaacaggtggcgcagcttcagcaccagctacagctgatccaaaccgtgtc
atccaagccatgccttctgttcgtaaatatgcacgcgacaaaggcgttgacatcagctta
gtaaacggcaccggtaagaacggccaaattacccgtgatgacatcgacaacttcgatcca
aacgctcaagctgcaagcagccaagaagctagccaagaagcagctccagctaaggaagaa
aaagcagctaagaaatcacctgctccagcgccaactgtttctaacgaagacttggttgaa
cgcgttaagatctcaccaatgcgtcggatcatctctgaatccatgaccacttctaagttt
actgcacctcaagtatccctcttcatggacgttgaagtgtctaaactttgggatcatcgt
aagaaattcaagggcatcgctgcagaacgtgatgtgaagttaaccttcttaccttatgtg
gtgaaagccttagttgctgcagttaagaaatacccaatgcttaacgcatcaatcgacgaa
gaaaaccgcgaatacatccttaagaaatactataacgtagggattgcaacagatactgac
aatggtttattcgttccaaatatcaagaacgctaaccaaaaatcaatgtttgaaattgct
aacgaaatcaacgaaaaagctgccaaagctcacgctggtgaattaaccaacgaagaaatg
ggcgacggtaccattacaatttctaacatcggttcagctggtggcgaattcttcactcca
atccttaacttcccagaagttgctatcttaggtttcggtgccatcaagcaagaacctgtt
gtcaacgatgaaggcgaattagcagttggccgcgtcttgaaactttccttaaccttcgac
caccgtattgtcgacggggctgtaggtcaacgttgcttgaacgaagtcgctcgcttattg
tcagaaccagaattgctgttaatggaaggatag

DBGET integrated database retrieval system