KEGG   Acidilobus saccharovorans: ASAC_0830Help
Entry
ASAC_0830         CDS       T01283                                 

Definition
(GenBank) hypothetical protein
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
asc  Acidilobus saccharovorans
Brite
KEGG Orthology (KO) [BR:asc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ASAC_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: ADL19236
UniProt: D9Q1P8
Position
complement(845187..845522)
Genome map
AA seq 111 aa AA seqDB search
MAALVVLVTAPKGDGTRIAKELLDGKVAACVNVIPGVHSSYWWEGKVEEAEEDLLIIKTT
EEAYDRLEELIRRVHPYKVPEVLALRVERGLPEYLSWLEGSVSPRGQQAKA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
ttggcggccctcgtggtcctggtgacggcgcccaagggcgacggcaccaggatagccaag
gagctgctggacggcaaggtagcggcctgcgttaacgtgatacctggggtccacagctcc
tactggtgggagggcaaggtagaggaggctgaggaggacctgcttataataaagaccacg
gaggaggcctacgacaggcttgaggagctcataaggagggtccacccgtataaggtgcct
gaggtcctggcgctcagggttgagagggggcttccggagtacctctcctggcttgaaggc
tcagtttcgcccaggggtcagcaggctaaggcttga

DBGET integrated database retrieval system