KEGG   Acidilobus saccharovorans: ASAC_0852Help
Entry
ASAC_0852         CDS       T01283                                 

Definition
(GenBank) pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc00020  Citrate cycle (TCA cycle)
asc00620  Pyruvate metabolism
asc01100  Metabolic pathways
asc01110  Biosynthesis of secondary metabolites
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
Module
asc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0852
   00020 Citrate cycle (TCA cycle)
    ASAC_0852
   00620 Pyruvate metabolism
    ASAC_0852
Enzymes [BR:asc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ASAC_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh FAM194
Motif
Other DBs
NCBI-ProteinID: ADL19258
UniProt: D9Q1S0
Position
862235..862912
Genome map
AA seq 225 aa AA seqDB search
MPTQRRLAGAEEFFAASMTLREAGPRLSLMRLMSFDGMIKAREELSRKAPLQRLTPTVIL
LKVMGALLSRPQYNELNSRVDQDTVITYESVNVALPIYRERGRTTVIVVEDVNRKTVEEL
SSEVRSAKEGTDYSKATFLLVNLGVMGIDAITGISLPGIASSVAIGRIRKGPVYDEARDR
TVTANIAWVTLTVDPRVVGPDVTGSFLADLASVLANKDLVLQLLS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccagaggaggttagcgggcgctgaggagttcttcgccgcatctatgacgtta
cgtgaggcgggccccaggcttagcctcatgaggctcatgtcatttgacggcatgattaag
gcgagggaggagctcagcaggaaggcgccgcttcagaggctcacgccgacggtaatcctg
cttaaggttatgggcgccctgctctcaaggccccagtataatgagcttaactccagggtt
gaccaggacacggttataacttacgagtccgtcaacgtagcgctcccaatatatagggag
agggggagaacgacagtcatagtagttgaggacgtaaacaggaagaccgttgaggagctg
tcctcagaggtgaggtcggccaaggagggcaccgactactcaaaggccacgttcctcctc
gtaaacctcggcgtgatgggcatagacgccataactggcatcagcctgcccggcatagcc
tcgtcggtagcgataggcaggatcaggaaggggcctgtctacgacgaggccagggatagg
acggtcactgcgaacatagcgtgggtcacgcttactgtggacccaagggtggtggggccg
gacgtcacagggtccttcctggcggacctggccagcgtgctggctaacaaggacctggtg
cttcagctcttgtcttga

DBGET integrated database retrieval system