KEGG   Acidilobus saccharovorans: ASAC_0878Help
Entry
ASAC_0878         CDS       T01283                                 

Definition
(GenBank) ADP-dependent hexokinase (HK)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc00052  Galactose metabolism
asc00500  Starch and sucrose metabolism
asc00520  Amino sugar and nucleotide sugar metabolism
asc00521  Streptomycin biosynthesis
asc01100  Metabolic pathways
asc01110  Biosynthesis of secondary metabolites
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0878
   00052 Galactose metabolism
    ASAC_0878
   00500 Starch and sucrose metabolism
    ASAC_0878
   00520 Amino sugar and nucleotide sugar metabolism
    ASAC_0878
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ASAC_0878
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ASAC_0878
Enzymes [BR:asc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ASAC_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ADL19284
UniProt: D9Q1U6
Position
complement(890540..891526)
Genome map
AA seq 328 aa AA seqDB search
MWAGEPMGRIIAVDIGATNLRVALFEGERPVAVRKTQTPRTSGSDLVKAIVDLVRDVSGG
YDFEAIGVASIGPLDLRNGTLLWAPNLGYGNVNIRDSLGSEFQRPVYLTNDALAGAWAEK
VLGAGKELEDLAYVTMSTGLGVGAVVDGNLIVGRRGNAHELGHSIVDFESELRCGCGGNG
HWEAYVGGRNIPRTAQYLTSRWSGPRTKAFELASRGELSPEALYSMARQGDEFARYAVSF
INRVHAAGMMNIIAAYDPEAIFIGGSIYLYNEDLIKGELIEFMKEYVGVFGVPRIERCTF
GDDEVLYGAAATAINPPQAIARSAYRPR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggccggggagcctatgggaaggataatagccgttgacataggcgctaccaacctg
agggttgccctgtttgagggcgaaaggcccgtcgctgtaaggaagacgcagacgcctagg
accagcggcagcgacctagttaaggcgatagtagacctggtaagggacgtgagtgggggc
tacgactttgaggccataggagtggcctccataggcccccttgacctaaggaatgggacc
ctgctctgggcccccaacctgggctatggtaacgttaacataagggactccctgggcagc
gagttccagaggccggtctacctcaccaacgacgcgctggcaggcgcctgggctgagaag
gtcctgggggctggcaaggagctcgaggacctggcctacgtcactatgagcacgggcctt
ggagtaggcgctgtagttgatggtaacctcatagttggaaggaggggcaacgcgcacgag
ctgggacatagcatagttgacttcgagtccgagctcaggtgcggctgcgggggcaacggc
cactgggaggcctacgtgggagggaggaacatacccaggacggcccagtacctaacgtcc
aggtggtcagggcctcgcactaaggccttcgagctcgcctccaggggcgagctcagccca
gaggccctctactcaatggccaggcagggcgacgagttcgcgcgctacgcggtgagcttc
ataaacagggtccacgcggccggcatgatgaatataatcgccgcctacgaccccgaggcc
atattcatagggggcagcatatacctgtacaacgaggacctgataaagggcgagctaata
gagttcatgaaggagtacgtgggcgtcttcggcgtgcctagaatagagaggtgcacgttt
ggggacgacgaggtgctttacggtgccgcggccacagcgataaatccgccgcaggccata
gctaggagcgcctacaggccaaggtag

DBGET integrated database retrieval system