KEGG   Hoyosella subflava: AS9A_0958Help
Entry
AS9A_0958         CDS       T01514                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
asd  Hoyosella subflava
Pathway
asd00071  Fatty acid degradation
asd00280  Valine, leucine and isoleucine degradation
asd00281  Geraniol degradation
asd00310  Lysine degradation
asd00360  Phenylalanine metabolism
asd00362  Benzoate degradation
asd00380  Tryptophan metabolism
asd00410  beta-Alanine metabolism
asd00627  Aminobenzoate degradation
asd00640  Propanoate metabolism
asd00650  Butanoate metabolism
asd00903  Limonene and pinene degradation
asd00930  Caprolactam degradation
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AS9A_0958
   00650 Butanoate metabolism
    AS9A_0958
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_0958
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS9A_0958
   00310 Lysine degradation
    AS9A_0958
   00360 Phenylalanine metabolism
    AS9A_0958
   00380 Tryptophan metabolism
    AS9A_0958
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS9A_0958
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AS9A_0958
   00281 Geraniol degradation
    AS9A_0958
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS9A_0958
   00627 Aminobenzoate degradation
    AS9A_0958
   00930 Caprolactam degradation
    AS9A_0958
Enzymes [BR:asd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AS9A_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEF39410
UniProt: F6EPH7
Position
complement(984622..985404)
Genome map
AA seq 260 aa AA seqDB search
MAAAVSSVHTGKHIRVITMNAPPVNALTVQGWFDVANAITAAGDDPDCHVVVLRADGRGF
NAGVDIKEIERSEGYSALIGANQGCAAAFAAVYDCKVPVIAAVNGYCLGGGIGLVGNADI
VIASDDATFGLPEVDRGALGAATHLARLVPQHLMRALYYTASTITAQQLLHHGSVYRVVP
RDELDEAALEVARAIAAKDTRVIRKAKEAINGIDPQPVHRSYRYEQGFTFELNLAGVSDG
ARQEFLARSGGHSNGGSTHG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccgtcagttcggtccacaccggaaaacacatccgggtgataacgatgaac
gccccaccggtcaacgctttgacggtgcagggatggttcgacgtggcgaacgcgatcact
gccgcgggagacgaccccgattgccatgtggttgttttgcgtgcagacgggcgtggcttc
aacgccggggtcgacatcaaagagatcgagcgcagcgaagggtactcagcactcatcgga
gcaaaccagggttgcgccgccgcgttcgccgcggtctatgactgcaaagtgcctgtgatc
gcggccgtgaacggttactgcctcggtggtggtatcgggcttgtcggcaacgccgatatc
gtcatcgcgtctgacgacgcgacgttcggcctgcctgaggtcgaccgcggcgccctcggg
gcagccacccacctggcccgcttagtcccgcaacatttgatgcgcgccctgtactacacc
gcgagcaccattaccgcacagcaacttctgcaccacggatccgtttaccgcgtcgtcccg
cgcgacgagctcgacgaagcggccctcgaggttgctcgtgctatcgcggccaaagacacc
cgagtgatccgcaaagcaaaggaagccatcaacgggattgacccgcagcccgtccaccgc
agctaccgatacgaacagggattcacgttcgaactaaacctcgccggcgtatcagacggt
gcgcgacaagaatttctcgcacgatcaggtgggcattccaacgggggcagcacacatggc
tga

DBGET integrated database retrieval system