KEGG   Hoyosella subflava: AS9A_0964Help
Entry
AS9A_0964         CDS       T01514                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asd  Hoyosella subflava
Pathway
asd00071  Fatty acid degradation
asd00072  Synthesis and degradation of ketone bodies
asd00280  Valine, leucine and isoleucine degradation
asd00310  Lysine degradation
asd00362  Benzoate degradation
asd00380  Tryptophan metabolism
asd00620  Pyruvate metabolism
asd00630  Glyoxylate and dicarboxylate metabolism
asd00640  Propanoate metabolism
asd00650  Butanoate metabolism
asd00900  Terpenoid backbone biosynthesis
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
asd01212  Fatty acid metabolism
asd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS9A_0964
   00630 Glyoxylate and dicarboxylate metabolism
    AS9A_0964
   00640 Propanoate metabolism
    AS9A_0964
   00650 Butanoate metabolism
    AS9A_0964
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AS9A_0964
   00072 Synthesis and degradation of ketone bodies
    AS9A_0964
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS9A_0964
   00310 Lysine degradation
    AS9A_0964
   00380 Tryptophan metabolism
    AS9A_0964
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AS9A_0964
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS9A_0964
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AS9A_0964
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asd04147]
    AS9A_0964
Enzymes [BR:asd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AS9A_0964
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AS9A_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEF39416
UniProt: F6EPI3
Position
complement(989344..990504)
Genome map
AA seq 386 aa AA seqDB search
MRHPVIIDAVRTPIGKRNGWLSGLHPAEILGATHTALIERNQLDPSSIEQVIGGTVTQAG
EQAGNITRTAWLHAGLPQKTGATTIDAQCGSAQQAAHLISGLIAAGAIDGGIACGVESMS
RIPLGANRGQGIGTPRPESWAIDMPNQFAAAERIAKRRGLSRSEVDEFAVASQQKALTAW
AEGRFEREVVPVKAPIFSDGAPTGESQLVSRDQGPRDSTAEGLAKLKAVLEDGVHTAGSS
SQISDGAAAVLIMEESRARELGLKPRARIVAQALIGDDPYYHLDGPIAATSRVLAKSGMS
IKDIDLFEVNEAFASVVMSWQQVHQPDPARVNVNGGAIALGHPVGSTGARLITTALHELE
RRDASTALIAMCCGGAMATGSIIERI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaccctgtcatcattgacgcggttcggaccccgatcggtaaacgcaacggctgg
ctctccggtctgcaccccgccgaaatcctcggcgccacccacaccgcactgatcgagcga
aaccagctcgatccgagctcgatcgagcaggtcatcggcggaacagtcacccaggcaggc
gagcaagccggcaacatcacgcgtaccgcatggctccacgcagggctgccgcaaaaaacg
ggtgcgaccacgatcgacgctcaatgtggctccgcacagcaggccgcccaccttatttcg
ggcctgatcgctgccggagccatcgatggcggcattgcctgcggcgtcgaatcgatgagt
cgcatccccctaggcgcaaaccgtggccagggcatcggcacaccacgccccgagtcctgg
gcaattgatatgccaaatcagttcgccgccgcggaacgcattgccaagcggcgcggactc
agtcgcagcgaggtcgacgagttcgccgtcgcgtcccagcagaaggcgctgacagcctgg
gcagaaggccgattcgaacgcgaagtcgttcccgtcaaagctccgattttcagtgacggt
gcacccactggtgaatcgcagctcgtctctcgggaccaagggccgcgcgacagcacggcc
gaagggcttgccaagctcaaagcagtactcgaagacggtgttcacaccgcaggcagttcg
tcacagatctccgacggcgccgccgcagttctcatcatggaggaatcgcgagcccgcgag
ttggggctgaaaccgcgcgcccgcatagtggcgcaggcgctcatcggcgacgacccctac
taccatctcgacggccccatcgcggcgacatcgcgcgtgctggccaagagcggaatgtcg
atcaaggacatcgacctattcgaagtgaatgaagccttcgcgtcagtagtcatgtcctgg
cagcaagtgcatcagcccgacccggccagagtaaacgtcaacggtggcgccatcgcgctc
ggccacccagttgggagcaccggtgcccgcctgattacaactgcactgcacgagctcgaa
cgccgcgacgccagtaccgccctgatcgccatgtgctgcggcggagcgatggcgacaggt
tcgatcatcgagcgaatttag

DBGET integrated database retrieval system