KEGG   Hoyosella subflava: AS9A_1455Help
Entry
AS9A_1455         CDS       T01514                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
asd  Hoyosella subflava
Pathway
asd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01130  Biosynthesis of antibiotics
asd01230  Biosynthesis of amino acids
Module
asd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AS9A_1455 (trpC)
Enzymes [BR:asd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AS9A_1455 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: AEF39907
UniProt: F6EH70
Position
1508540..1509355
Genome map
AA seq 271 aa AA seqDB search
MTVLDSILDGVRADVAARQARLDIGEVKKLAQKAPNPVDAAAALREPGIAVIAEVKRASP
SRGELADIRDPAELAREYELGGARIISVLTEERRFHGSLADLDAVRATVKIPILRKDFVV
GPYQIHEARAHGADVILLIVAALEQDVLVSLLDRTESLGMTALVEVHTEQEADRALEAGA
RVIGVNARDLKTLEVDRNCFARIAPGLPSDVIKVAESGIRGPADLLAYAGAGADAVLVGE
GLVTSGDPRAAVSDLVTAGTHPSCPKPARNS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggttctcgactccatactcgacggtgtgcgggcggatgtcgctgccagacaagcg
cgtcttgacatcggcgaagtgaaaaagctcgcccagaaggcgcccaatccggtcgatgcg
gcggcagcgctgcgcgaacccgggattgcggtcatcgctgaggtaaagcgagcgagcccg
tcacgcggtgaattggctgacatccgcgatcctgctgaactcgcgcgagaatatgaactc
ggcggcgcccgaattatcagcgtgctaactgaggagcgtcgtttccacggttcgctcgcg
gatctggatgcagtccgcgcgactgtgaagattcccattttgcgcaaggactttgtcgtg
gggccgtatcagatacatgaggcgcgcgcccacggtgcggacgtcatcctgttgatcgtg
gccgcccttgagcaagacgttctcgtctcgctgctagaccggacggagtcactcggtatg
acagcgctcgtggaggtccatactgagcaggaagcggatcgcgcactcgaggcgggagcc
cgagtgatcggcgtgaacgcgcgggacctgaaaaccctcgaggttgatcgcaactgcttc
gcacgtatcgccccggggctgcccagcgacgtcatcaaggtcgcggagtcgggcattcgc
ggaccggctgatctgctcgcgtacgcgggtgccggtgcggacgccgtgcttgtcggcgaa
ggcctggtgactagtggtgatccgcgcgcagcggtgtcggatctggtcactgcggggacc
catccgtcgtgcccgaagccagcgcggaactcgtga

DBGET integrated database retrieval system