KEGG   Hoyosella subflava: AS9A_1606Help
Entry
AS9A_1606         CDS       T01514                                 

Definition
(GenBank) Mycothione reductase
  KO
K17883  mycothione reductase [EC:1.8.1.15]
Organism
asd  Hoyosella subflava
Brite
KEGG Orthology (KO) [BR:asd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AS9A_1606
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.15  mycothione reductase
     AS9A_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_9 K_oxygenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AEF40055
UniProt: F6EIZ4
Position
complement(1666707..1668083)
Genome map
AA seq 458 aa AA seqDB search
MDHFDIAIIGAGSGNMIVNRRFADKAVAIIEENRFGGTCLNVGCIPTKMFAYTADVAASI
DSASRFGIDAEVHGVDWQAIVKRVFSRIDGNVAAAEQFRQDNPNVTVFKEHASFTGSSTV
ELSSGARISADQFVIATGARATVPEGLPRPSDSPNDRRPIYTSDTIMRAETFPQRLVILG
GGFIAAEFAHIFSSLGSAVTVISRGERLLRHHDAAVSGLFTDVARSRWDVRLSTTAESVE
SSADGVSVVLDDGSHVQGDALLLALGRRPNSDNLGLENAGVSVHLDGRVVVDDCQQTTAS
GIWALGDVCAPIQLKHLANHEAHVVAHNLLNPESPRAANHRFIPSGVFTYPQIASVGLTS
EQAEDAGIDVAESTHEYKDTAFGWATEDAPGFCKVLADRSTGQLIGAHIVGAHATTAIQP
LIQGMVFGTTPKRLARDQFWIHPALAEVVENALIGLRI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaccatttcgacatcgccataatcggtgcggggtccggcaacatgatcgtgaaccgc
cgcttcgccgacaaggcagttgcgattatcgaagagaaccgtttcggcgggacatgtctc
aacgtcgggtgtattccgacgaaaatgttcgcctataccgctgatgtcgccgcgtcgatc
gacagcgcttcccgattcggcatcgatgcggaggtacacggcgtcgactggcaagcgata
gtgaagcgcgtcttctccagaatcgacggcaacgttgccgctgctgaacagttcaggcag
gacaacccgaacgtgacggtcttcaaggaacacgcgagcttcaccggctccagcaccgtg
gagttgtccagcggagcccgcatttccgccgatcagttcgtgatcgctacgggcgcgcgc
gcgacggtccccgaaggtctcccgcgccccagcgactctcccaacgacaggcgcccgatc
tatacctcagacaccatcatgcgcgctgagacattcccgcagcgtctggtgattcttggt
ggcggtttcatcgccgccgagttcgcacacatattctcctcgctcggcagcgccgtcact
gtgatatcccgtggcgagcggctgctgcgccatcacgatgcggcggtctccggtttgttc
accgacgttgcgcggtcacgctgggacgtacgcctgagtacgactgccgaatctgttgag
tcatcagcggacggggtgagcgtggttctggatgacggctcgcacgtgcagggtgatgct
cttctcctggccctcggtcggcgtccaaacagcgataatctgggcctcgaaaacgctggc
gtgtcggtccatctcgacggtcgtgtggtggtcgacgactgtcagcaaacgaccgcttcc
ggcatttgggcgctgggcgacgtctgcgccccgatccagctgaagcacctcgccaatcac
gaggctcacgtcgtcgcgcacaatctgctcaaccccgagtcgcccagggctgccaatcac
cgtttcataccgtcaggggtcttcacctatccgcagatcgcgagcgtggggctcaccagt
gaacaggctgaggatgcgggaattgacgtcgcggaatcgactcatgagtacaaggacacg
gcgtttgggtgggccacagaggacgcccctggattctgcaaggtacttgccgatcgttca
actggacaactgatcggcgcgcacatcgtcggcgcgcacgcgaccaccgccatccagccg
ctaattcagggaatggtgttcggtaccacacccaagcggctggcccgcgaccagttctgg
atacaccccgcgctcgccgaagtggttgagaatgcgctgatcggactgcgtatttag

DBGET integrated database retrieval system