KEGG   Hoyosella subflava: AS9A_1765Help
Entry
AS9A_1765         CDS       T01514                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
asd  Hoyosella subflava
Pathway
asd00010  Glycolysis / Gluconeogenesis
asd00520  Amino sugar and nucleotide sugar metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Module
asd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_1765
   00520 Amino sugar and nucleotide sugar metabolism
    AS9A_1765
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AS9A_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEF40214
UniProt: F6ELG4
Position
complement(1835967..1836749)
Genome map
AA seq 260 aa AA seqDB search
MHTEPQTPSADSPPPRLGLGVDIGGSGVKGAVVNLETGVLATERIRIDTPQPATPGAVAA
TVAAIVKEFDWDGPVGVTVPAVVKHGVTYSAANIDPTWIGTDARALFTAELDGRKVTVLN
DADAAGLAEQKFGSGRDENGLVILLTFGTGIGSALLYNGILIPNSELGHLEVGGKKAEHR
AAASVRERNDLSWTDWAAEVSTVLSTYDALFSPDLFIAGGGVSKKSDKWIPLLTTQTRII
PAQLRNTAGIVGGAVAAYSD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgagccacagacaccgtccgccgacagcccgccaccccggctgggtctgggt
gttgatatcggcggcagcggcgtcaaaggtgccgtcgtgaaccttgaaaccggagtgctg
gccactgagcgtatccggattgacacccctcagcccgcgacccccggagcggtcgcagca
actgtggcggcgatcgtgaaggagttcgactgggacgggcccgttggcgtcaccgttccc
gcggtcgtcaaacatggcgtgacatacagcgccgcaaacatcgaccccacatggataggt
acggacgctcgggctctcttcacagcagaactcgacgggcggaaggtcactgtccttaac
gatgccgatgcggcgggactcgccgaacagaagttcggatctggccgtgacgagaacggc
ctcgtcatcctgttgactttcgggacaggtatcggttcagcgctgctctacaacggaatt
ctgattccgaatagcgagctgggccatctggaagtcggcggaaaaaaagcggagcaccgt
gccgcggcatctgttcgtgaacgcaatgatctgagctggacggactgggccgcggaggta
tccaccgtgctcagcacctacgatgcgctcttctccccggacctcttcatcgcgggcggc
ggcgtgagcaaaaaaagtgacaagtggatcccgctcctgacaacgcaaacgcgcatcatc
ccagcccagttgcgtaacaccgcgggaatcgtgggcggggccgttgccgcatattcggat
taa

DBGET integrated database retrieval system