KEGG   Hoyosella subflava: AS9A_2114Help
Entry
AS9A_2114         CDS       T01514                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
asd  Hoyosella subflava
Pathway
asd00010  Glycolysis / Gluconeogenesis
asd00071  Fatty acid degradation
asd00350  Tyrosine metabolism
asd00625  Chloroalkane and chloroalkene degradation
asd00626  Naphthalene degradation
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_2114
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_2114
  Amino acid metabolism
   00350 Tyrosine metabolism
    AS9A_2114
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AS9A_2114
   00626 Naphthalene degradation
    AS9A_2114
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AS9A_2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEF40563
UniProt: F6EPT4
Position
2194558..2195595
Genome map
AA seq 345 aa AA seqDB search
MDGEVKRMRAWRVTVPGPVGLAPDARAPLTMVTEEVPEPADDELLVRVAACGVCRTDLHV
VEGDLPVHHPHVTPGHEVVGEIVASGAGVRGGFSAGDRVGVAWLRHTCGVCRYCRRGAEN
LCLSSRYTGWDADGGYADYATVPAKYALTLPAGYSDAELAPLLCAGIIGYHALLRAEVPK
GGTLGIYGFGGSAHLTAQVAIAQGARVHVMTRGDHARSLARELGAASAQGAAERPPEPLD
SAILFAPVGELVLPALEALDAGGTLALAGIHLTDIPPLNYQRHLFRERQIRSVTSNTRAQ
AQEFLDFAGRHSLSVTSHEYALESADQALRDLAAGRFSGAAVLVP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggacggtgaggtgaagcgaatgcgcgcatggcgggtgacggtgccgggcccagtcggg
cttgccccagatgcgcgggcaccgctgactatggtgaccgaggaggtaccagaaccggcg
gacgacgagctactcgtgcgcgtagcggcgtgtggagtctgccgcactgatctgcacgtt
gtcgaaggtgacctgcccgtgcaccacccgcacgtcacgcccggacacgaagtcgtaggc
gaaatcgtcgcttccggtgctggagtacgaggaggcttctcggcaggagatcgcgtcggt
gttgcgtggctgcggcatacatgcggtgtgtgccgttactgccgccgcggcgccgagaac
ctgtgcttgagttcacgctacacaggctgggatgcggacggtggctatgccgactatgcg
acggtgcccgctaagtacgcactgactctccctgcgggctattcggatgctgaactcgcc
ccgttgctctgcgcaggaatcattggttaccacgctttgctccgcgcggaggttccaaaa
ggcggcacactgggtatatatggtttcggcggcagtgcacatttgactgcccaggtcgcg
atcgcgcagggcgcccgagtgcatgtgatgacgcgtggtgaccatgcgcggtcactcgct
cgtgaactcggtgcagcctccgcccaaggtgcagcagaacgtcctccggagccgctcgat
tcagcgatcctcttcgcccccgtcggtgaactcgtacttcccgcactcgaggcgctggat
gcgggcggcacgctcgcgcttgcggggattcaccttacagatattccgcctctgaactat
cagcgtcatctgttccgtgagcgtcagattcgaagcgtcacgtcgaatacgcgcgcgcag
gcgcaggagtttcttgacttcgctggcaggcattcgttgtcggtcacgagtcacgagtac
gcgcttgagtcggcggaccaggcgcttcgtgacctcgctgcgggccgattcagcggagcc
gcggtcctcgtcccataa

DBGET integrated database retrieval system