KEGG   Hoyosella subflava: AS9A_2575Help
Entry
AS9A_2575         CDS       T01514                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
asd  Hoyosella subflava
Pathway
asd00010  Glycolysis / Gluconeogenesis
asd00030  Pentose phosphate pathway
asd00051  Fructose and mannose metabolism
asd00052  Galactose metabolism
asd00680  Methane metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
asd01230  Biosynthesis of amino acids
Module
asd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_2575
   00030 Pentose phosphate pathway
    AS9A_2575
   00051 Fructose and mannose metabolism
    AS9A_2575
   00052 Galactose metabolism
    AS9A_2575
  Energy metabolism
   00680 Methane metabolism
    AS9A_2575
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AS9A_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEF41022
UniProt: F6EGG9
Position
complement(2622395..2623318)
Genome map
AA seq 307 aa AA seqDB search
MASIVTLTLNPALDVDTTTKEVRPTSKLRCGPARYDAGGGGINVARVAHTLGESACAVYP
AGGPVGNALQEILAGAGIGTRCINIQGATREGITVNETSTGKQYRFVLPGPELAITEQDE
CLAAVAEECEQADFVVASGSLPPGVDSEYYSRVVAVARDAGAQVILDTSGDALRDAAGVF
LVKPNLGELARLTGRSLEDEEGRAAAARSLIESGRAENVVISLGAEGAMLVTADDVAVLP
PIEVPIRSAVGAGDTMVAGITVGLSRGWEMVRAVQLGVAAASATLITEGTGLCRRADVDR
LFGEYTD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccagcattgtcactctgacactgaacccggcacttgacgtcgacacgacaacaaag
gaagtgcgcccgaccagcaagctacgctgcgggcccgcgagatatgacgccggcgggggc
ggcataaatgtcgctcgtgtcgcacacactctcggtgaatcggcgtgcgctgtttaccca
gctggcggacccgtcggcaacgcgcttcaagagatcctcgccggggcgggcattggaacg
aggtgcatcaacattcagggcgcgacgagggaaggcattacggtcaacgagacatcaacc
ggcaagcagtaccgtttcgtactgccaggccccgagctggcgatcactgaacaggatgag
tgtctggcggctgttgccgaggaatgcgagcaggccgatttcgtagtcgcgagcggcagt
ttgccgccaggcgtggattcggagtactactcgcgggtggtggccgttgcgcgcgatgcg
ggggcccaggtcatcctcgacacgtctggtgatgccctgcgtgacgccgcaggagttttt
ctggtgaagcccaatctcggtgaactggcgcgactcacggggcgttccctggaagacgag
gagggccgcgccgccgccgcccgcagccttattgagagcggacgagccgagaacgtcgtg
atttcgctcggcgccgagggtgcaatgctggtcaccgccgacgacgtggcggtgctgcca
cctattgaggtgccgatccgaagcgcggtgggagcgggagacacgatggttgcgggtatc
actgtggggctgtcgcgcggatgggagatggtgcgcgccgtgcagctcggggttgccgcg
gcgtcggctacgttgatcaccgaaggcaccggcctctgccgtcgcgcagatgttgatcgg
ctgttcggtgaatacaccgattga

DBGET integrated database retrieval system