KEGG   Hoyosella subflava: AS9A_3557Help
Entry
AS9A_3557         CDS       T01514                                 

Gene name
galU2
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asd  Hoyosella subflava
Pathway
asd00040  Pentose and glucuronate interconversions
asd00052  Galactose metabolism
asd00500  Starch and sucrose metabolism
asd00520  Amino sugar and nucleotide sugar metabolism
asd01100  Metabolic pathways
asd01130  Biosynthesis of antibiotics
Module
asd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AS9A_3557 (galU2)
   00052 Galactose metabolism
    AS9A_3557 (galU2)
   00500 Starch and sucrose metabolism
    AS9A_3557 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    AS9A_3557 (galU2)
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AS9A_3557 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: AEF41995
UniProt: F6ERB7
Position
complement(3629800..3630768)
Genome map
AA seq 322 aa AA seqDB search
MTEANGQLVPPFRTAIVPAAGLGTRFLPVTKTVPKELLPLVDTPAIELVASEAAEAGAGR
LVIITSEGKEGVLAHFVRHEILEGTLERRGKHALLDKVRRAPALMDVEAVVQEEPLGLGH
AIACAEAALDDDEKEIAILLPDDLVLPTGVLSQMAEVRARYGGSVLCAIEVDPKEVSAYG
VFAVEATGDPAEAGQVMRVTAMVEKPPVDQAPSNLAAAGRYLLDREIFDALRRITPGRGG
ELQLTDAIELLVEDGHPVHVFVHKGTRHDLGNPGGFLKAAVDFALDDEEYGPDLRTWIAE
RLGLNVPDGDASAQSGVTAAGR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggccaatgggcagttggtaccgccgttccgcacggcgatcgttcctgctgcc
gggctcgggacgcggttcttgccggtcaccaagaccgtcccgaaagagcttttgccgttg
gtcgatacaccagcaatcgagctggtagcgagtgaagccgcggaagcgggtgccggtcgc
ctggtgatcatcacttccgaaggtaaagaaggcgtcctcgcgcacttcgttcggcacgag
atcctcgaaggcacattggagcggcgcggcaagcacgcgctgctcgacaaggtacgccgc
gctcctgcgctgatggacgtcgaagccgtcgttcaggaagagccgctcgggcttggtcac
gctattgcgtgtgccgaagcagcactcgatgacgacgagaaagaaatcgccatcctcttg
cctgacgacctggtacttcccactggtgtgctctcccagatggccgaagttcgcgctcgg
tacgggggcagcgtcctctgcgctatcgaagtggatccgaaggaagtcagcgcttacggt
gttttcgccgtcgaagcgaccggcgatcccgcggaagccggccaagtgatgcgcgtcact
gcaatggtggagaagcctcccgtcgatcaagctccgtcgaatctcgctgccgcgggccgc
tacctgctcgaccgcgagatctttgacgctctgcgccggatcaccccaggacggggaggc
gaactccagctcaccgacgcgattgagcttctcgtcgaagacggccaccccgtgcatgtt
tttgtccacaagggaacccgacacgacctcggaaatcccggcgggttcctcaaggctgcg
gttgactttgcactcgacgatgaggagtacggcccagacctccgcacgtggattgcggag
cgtctcgggctgaacgttcccgacggtgacgcgtccgcgcagagcggagtcacggcagcg
gggaggtga

DBGET integrated database retrieval system