KEGG   Hoyosella subflava: AS9A_3583Help
Entry
AS9A_3583         CDS       T01514                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
asd  Hoyosella subflava
Pathway
asd00020  Citrate cycle (TCA cycle)
asd00640  Propanoate metabolism
asd00660  C5-Branched dibasic acid metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Module
asd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS9A_3583 (sucC)
   00640 Propanoate metabolism
    AS9A_3583 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AS9A_3583 (sucC)
Enzymes [BR:asd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AS9A_3583 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: AEF42021
UniProt: F6ERE3
Position
complement(3649744..3650913)
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHGVPTTPGRVADTAEEAEQIAAEIGKPVVVKAQVKTGGRGKAGGVK
LASDPADAKAKAEGILGLDIKGHVVKRLLVAEASDIKEEYYISFLLDRANRTFLAMCSKE
GGVEIEQVAAETPDALARVAVDPNEGVDLAFARKIAEGGKLPAEVLDAAAETIAKLWEVF
VKEDTLLVEVNPLVRTPDDQILALDGKVTLDGNADFRQPEHEEFVDAEAADPLEAKAKAK
GLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEEFGGVKPANFLDIGGGASAEVMANGLD
VILNDPSVKSVFVNVFGGITACDAVANGIVNALEILGDDANKPLVVRLDGNNVVEGRRIL
DEAAHPLVQQVDTMDGAAARAAELAAAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaagcgaaagaacttttcgcgaagcatggagtccccaccact
ccggggcgagtggctgacactgcggaggaagccgagcagatcgctgcggaaatcggcaag
ccagttgtagtgaaggctcaggtcaaaaccggaggccgtggcaaagcgggcggcgtcaag
ctcgcctcggatcccgccgacgcaaaggcgaaggctgaggggatcctcggactcgacatc
aaaggacacgtcgtcaagaggctcctcgtcgctgaagcgagcgacatcaaagaggagtac
tacatttccttcctcctcgaccgcgccaaccggaccttcctcgcgatgtgttccaaagaa
ggcggcgtcgagatcgagcaggtcgcggctgaaacgcccgacgctctcgcgcgggttgcg
gtagacccaaacgagggagtcgaccttgcgttcgcacgcaagatcgcagaaggcggcaaa
ctcccggctgaggtcctggacgcggcagcggaaacaattgccaagctctgggaggtcttc
gtcaaggaagataccctcctggtagaggtcaaccctctggttcgcacaccggatgaccag
attcttgcactcgatggcaaggtgacactcgatggcaacgcagacttccgtcagcctgag
catgaagagttcgtcgacgcagaggctgctgacccactcgaagccaaggccaaggctaaa
ggcctgaactacgtgaagctcgacggtgaggtcggcatcatcggtaacggcgccggactt
gtgatgtccacgctcgacgtcgtcgcgtacgccggtgaagagttcggcggtgtgaagccc
gcgaacttcctcgacatcggtggcggtgcctcagcagaggtcatggccaacggtcttgat
gtcatcctcaacgatccgagcgtcaagagcgttttcgtcaacgtatttggcggcatcacg
gcgtgtgatgcggtagccaacggcatcgtgaacgcgctcgagatcctcggcgatgatgcg
aacaagccgctcgttgtccgtctggacggcaacaacgtagttgaggggcgccgcatcctc
gacgaagccgcgcacccattggtgcagcaagtagacaccatggacggcgcggcggcacgc
gccgctgaactcgccgctgcggcgaagtga

DBGET integrated database retrieval system