KEGG   Hoyosella subflava: AS9A_3688Help
Entry
AS9A_3688         CDS       T01514                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
asd  Hoyosella subflava
Pathway
asd00030  Pentose phosphate pathway
asd00480  Glutathione metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Module
asd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
asd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
asd_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AS9A_3688
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AS9A_3688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asd04147]
    AS9A_3688
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AS9A_3688
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AS9A_3688
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AS9A_3688
  Exosomal proteins of colorectal cancer cells
   AS9A_3688
  Exosomal proteins of bladder cancer cells
   AS9A_3688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEF42126
UniProt: F6EEY9
Position
3759097..3760572
Genome map
AA seq 491 aa AA seqDB search
MLTTQQVDTCDIVVFGGTGDLAMRKLIPSLYQRDRDGQLTSDSRIIAVSRAGLDGPGYRD
KVAAELPHFLPKDTYDSETVDAFLTRLHHVTLDVTSAEPWEELAALLTAVEDRVRVYYLA
SAPKLFGGICHRLQDNGLVSPQSRVVLEKPIGTDLASAQQINDEVGAVFSEEQIFRIDHY
LGKETVQNLLVLRFANTLLEPMWRSAAIDHVQITVSETVGVGNRIGYYDGSGALRDMVQN
HMLQLLCLVAMEPPNHYDRDSVRDEKLKVLQALKPLTGHNVHRNTVRGQYAPGSIDGQSV
PGYSEELEGQASNTETYVALKAEVNSWRWAGVPFYLRTGKRLDRRASEIVVQFKSVPHSI
FPAIDDEMIPPNRLVIRLQPDEAVRLHLVTKAPGPGGLRLREVPLNLSFAETFDERLPDA
YERLLMDVVRGNPMLFMRRDEVEAAWEWAEPILTAWQESQHLPKRYASGSHGPAAATALI
ERDGRTWNDEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccacgcaacaggtcgacacgtgcgacatcgtcgtattcggcggcaccggtgac
ctggcgatgcgcaagctcatcccgtcgctctaccagcgcgatcgcgatggccagctcacc
agcgactcacgaatcatcgccgtgtcccgcgcgggtcttgacggcccgggataccgggac
aaggttgccgctgagctgccgcacttcctgccgaaagacacctacgacagcgagaccgtc
gacgccttcctgacgcggcttcatcacgtcacactcgacgtcacgtccgcggagccgtgg
gaagagctcgccgctctcctcaccgcagtagaggaccgcgtccgcgtgtactacctcgcg
agtgccccaaaactcttcggtggcatctgccaccggctgcaagacaacggactggtcagc
ccccagtcccgggtcgtgctcgaaaagcccatcggcacagacctcgcctcggctcagcag
atcaacgacgaggtgggtgccgttttctcggaagagcagatcttccgcatcgaccactac
ctgggtaaggaaaccgtccagaacctgctggttctgaggttcgcgaacaccctgctcgaa
ccaatgtggcgctcggccgcaatcgaccacgttcagatcaccgtgagcgaaacagttggc
gtggggaaccgcatcggctactacgacggttccggcgcgcttcgcgacatggtgcagaac
cacatgctgcagctactctgcctagttgcgatggaaccgccgaaccactatgaccgtgac
tctgtacgcgacgaaaagctgaaggtcctacaggcgctcaagcctctgaccgggcacaat
gttcaccgcaatacagtgcgcgggcagtacgcccccggcagcatcgacggccagtccgtc
cccggctactccgaggaactcgaagggcaggccagcaacacggaaacatatgtcgccctg
aaagccgaggtcaacagctggcgctgggcgggcgtgccgttctatcttcgcaccgggaaa
cgccttgaccgtcgcgcctccgaaatcgtcgtgcagttcaaatcggtaccgcattcgatc
ttccccgccattgatgacgagatgatcccaccgaaccgcctggtcatccgactgcagccg
gatgaagccgtccgcctgcaccttgtcaccaaagctcctggcccaggtggattgcggctg
cgcgaagtacctctgaatctgagcttcgctgaaaccttcgacgagcggctgcccgacgcg
tacgaacgcctgctcatggatgttgtgcgtggtaaccccatgctcttcatgcgccgcgac
gaggtggaagcggcatgggaatgggcagagcccatcctcaccgcctggcaagaatcacag
cacctgcccaagcgctacgcctccggcagccacggcccggctgccgccaccgctctgatc
gagcgggacggccgtacctggaacgacgaggaatga

DBGET integrated database retrieval system