KEGG   Hoyosella subflava: AS9A_3690Help
Entry
AS9A_3690         CDS       T01514                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
asd  Hoyosella subflava
Pathway
asd00010  Glycolysis / Gluconeogenesis
asd00052  Galactose metabolism
asd00500  Starch and sucrose metabolism
asd00520  Amino sugar and nucleotide sugar metabolism
asd00521  Streptomycin biosynthesis
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Module
asd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_3690
   00052 Galactose metabolism
    AS9A_3690
   00500 Starch and sucrose metabolism
    AS9A_3690
   00520 Amino sugar and nucleotide sugar metabolism
    AS9A_3690
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AS9A_3690
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AS9A_3690
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AS9A_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEF42128
UniProt: F6EEZ1
Position
3762419..3763438
Genome map
AA seq 339 aa AA seqDB search
MTSIPSIESPWLVADIGGTNARFGVVTEPGGRPHQVKSLTGADYPDLASAIETYMATTSG
VGRPTVGGVAVAGPVSGDRFRLTNASWDFSVNATKQALSFRHLALINDFSALALAVPYLD
HNAVVPLGGGERNTDLPVAVIGPGTGLGVSGIVPHQGMWIPLATEGGHVTLPVETDLEAQ
IAALLRRRFGRVSAETVLCGVGLTRLYHCIAAIRGAESVIISPADVCARGRSGADPICVE
TLQVFCAMLGNFAGNVALTVGARGGVLIGGGILPRMRDVLQHSEFRARFENKAPMTGYVS
AISTELIIADSPALLGAAQWITQWLAQELTPTTSEGALV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgatcccttcaatcgaatccccctggctcgtcgccgatatcggcgggaccaac
gcgcggttcggtgtcgtcactgagcccggcggtcgtccccaccaggtcaaaagcctcact
ggggcggactacccggacctcgcctccgcgatcgagacgtacatggctaccactagcggc
gtaggccgccctacagtgggcggcgtggcagtcgcgggtcccgtcagcggtgaccgtttc
cggctgacgaacgcatcgtgggatttctctgtgaacgcgacgaaacaagcgctgagtttt
aggcacctcgcgctgatcaatgacttcagcgcgctcgctctcgcggtgccgtatctcgat
cacaacgcggtcgtcccgctcggtggaggcgaacgcaacacggacctccccgtcgctgtg
atcggccccgggacaggtctcggtgtctcgggcatcgtgccgcatcagggcatgtggatt
cccctcgccaccgaaggtggccacgtgaccctcccggtcgagacggacctcgaggcacag
atcgccgcactgcttcgacgccggttcggccgcgtcagcgctgaaaccgtgctgtgcggt
gtcggcctgacccggctgtaccactgcatcgcagcgatcaggggtgcagagtcggtcatc
atctcgcctgcggacgtgtgcgcacgcggcagatcgggcgcagaccctatctgtgtggag
acactccaggtattctgcgcaatgctgggaaactttgctggcaacgtcgcactcaccgtg
ggtgcgcgcggcggggtactgatcggcggcgggattctcccgaggatgcgtgacgttctc
cagcacagcgagttccgtgcgcgatttgaaaacaaagcccccatgacgggatacgtgtcc
gcgatctccaccgagctgatcatcgcggactcacctgcactacttggcgcagcccagtgg
ataacccagtggctggctcaggaactgacccccaccacctctgaaggagccctggtatga

DBGET integrated database retrieval system