KEGG   Hoyosella subflava: AS9A_4240Help
Entry
AS9A_4240         CDS       T01514                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
asd  Hoyosella subflava
Pathway
asd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AS9A_4240
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AS9A_4240
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AS9A_4240
    1.1.1.-  
     AS9A_4240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEF42673
UniProt: F6EL10
Position
complement(4363470..4364516)
Genome map
AA seq 348 aa AA seqDB search
MRAAVYYGPNKVSIDDVPDPSPAYGQVKVRVGFNGICGTDLHEYFAGPIFIPTTPHALTG
NQAPLVLGHEFSGTITEIGPGVDGFSEGDRVAIEPIYRCGTCGPCASGRYNICKFIGFHG
LMSDGGMAESTVVPQNMLHKLPDSVSLQLGALVEPMSVAYHAAKLGDVQAGDTAMVMGAG
PIGIGVWFALKGLGLDDVYVVEPSPVRRASIENLGAKTLDPTSVNVAEFIGDHTGGSGVD
AAYDAAGVQPAVETALQCIGAHKPLVSVAIYEKPLETPLLNLVMNESRIQGSLCYTGDDY
RAVIDLMADGHYDTTGWVTTIPIEQVVDEGFHALHAGKKMKVLIDPSL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggctgtgtattacggaccaaataaagtctccatcgacgacgtccccgacccg
tcacctgcttacggacaggtgaaggtacgcgtggggttcaacgggatttgcggaacggac
ctgcacgagtacttcgctggcccgatctttatcccgaccacgccgcatgcgctgaccggc
aaccaggcgccccttgtcctcgggcacgagttttcgggaacaatcactgaaattgggcca
ggagtggatggtttcagtgaaggtgatcgggtggccatcgaaccgatctaccgctgtggc
acgtgcggcccatgcgcgtcgggcaggtacaacatctgcaagttcatcggcttccacggg
ctgatgtcagacggcggtatggccgagtccaccgtggttccacaaaacatgctgcacaag
ctgcctgactcagtgtcgctgcaactcggtgccctcgtcgagcccatgtctgtcgcgtac
cacgctgcgaagcttggagatgtgcaggcaggcgacacggccatggtgatgggggccggg
ccgatcgggatcggcgtgtggttcgcgctgaagggactcgggctcgacgacgtctatgtg
gtggaaccatctccagtgcggcgcgcgtcgatcgaaaatctgggcgctaaaaccctcgat
ccgacgtcggtgaatgtcgcggagttcatcggtgaccacactggtggcagtggtgtcgac
gccgcctacgacgccgcaggtgttcagcccgcagtcgaaacggcgctgcaatgtatcggc
gcccacaaacctctggtgagtgttgccatctacgaaaagccgctggaaacgccgttgctc
aacctggtgatgaatgaatcgcgcatccagggctcactctgctacaccggcgacgactac
cgtgcggtcatcgacctcatggcggacgggcattacgacacgaccggctgggtcaccacc
atccccatcgagcaggtagtcgatgagggattccatgcgctgcacgcgggcaagaagatg
aaggtgctcatcgacccatctctgtga

DBGET integrated database retrieval system