KEGG   Actinoplanes sp. SE50/110: ACPL_1410Help
Entry
ACPL_1410         CDS       T02044                                 

Gene name
bglK
Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00460  Cyanoamino acid metabolism
ase00500  Starch and sucrose metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACPL_1410 (bglK)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ACPL_1410 (bglK)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ACPL_1410 (bglK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like PA14 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AEV82307
UniProt: G8S3E7
Position
complement(1474325..1476685)
Genome map
AA seq 786 aa AA seqDB search
MTDVDHLLDRLTLDEKVSLLTGQDFWSLPAMPRIGLRSVVMSDGPVGVRGTGWAPENPSI
ALPSPTALAASWDPELAVEAGRLLGQEARAKGVHVVLGPTVNLHRTPLGGRHFECYSEDP
LLTGEIAAGFVRGVQEHGVGTTVKHLVGNDFETERMTVDVRIPERALRELYLAPFERVVE
AGGWGVMSAYNGVNGASMAQNGRLQDEVLKREWGFDGVVVSDWRAARDTVGAALGGLDIA
MPAMDNPWGPRLAAAVRSGQVPVEVVDDKVRRLLRLAARVGALGAPPVVTAAAVDGGEVA
HRVAARSFVLTRNRGVLPLPPERTGGIAVIGALAQDARVLGGGSAQVAPPHVISPLDGIR
RVFGDVAYAVGADPRPFLPAAQGPGWSAFTIDLGAYRFEVPTAAVRWLGDPPGGLAVPDV
TTLELTTTYTPEIGGEHVFAVSGFGTFQLTVGGQELYRGSLHPPGTGRADLLLHPREQRF
PVRLAAGEPVRLTLRQSFAPGTAHSAGTTLGHRPPGPDADGLIAEAVDLARHCDVAVVVV
GTTEQVESEGFDRTSLALPGRQDELVARVAAANPSTVVVVNAGAPVLLPWADEVAAVLLT
WFPGQEAGAALAAVLSGAEEPGGRLPTTWPRHETDCPVLTVQPRDGVVTYDEGIFIGYRG
WRAAPLYAFGSGSGYTTWEYSGLTATATEVAVTVTNSGQRAGREVVQIYLSARDDGAVER
PERWLAGFASVTADAGERVTVRIPLPERAFQVWTDGWRTLPGRYTVIAAHALDDPRLTAE
IEKPQA
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgttgatcacctgctcgaccggctgaccctggacgagaaggtgtccctgctg
accggacaggacttctggtcactgcccgcgatgccgcgcatcggcctgcgctcggtggtg
atgtccgacggtccggtcggcgtccggggcaccggctgggcgccggagaacccgtcgatc
gccctgcccagccccaccgcgctggccgcctcctgggatccggagctggccgtcgaggcc
ggccggctgctcggtcaggaggcccgcgccaagggggtgcacgtggtgctcggcccgacc
gtcaacctgcaccgtaccccgctgggcggccggcacttcgagtgctactcggaggatccg
ctgctcaccggcgagatcgcggccggattcgtgcgcggggtgcaggagcacggcgtcggc
accacggtgaagcatctggtcggcaacgacttcgagaccgagcggatgaccgtcgacgtg
cggatcccggaacgggcgctgcgcgagctgtacctggccccgttcgagcgggtggtcgag
gccggcgggtggggcgtgatgagcgcgtacaacggggtcaacggcgcgtcgatggcgcag
aacggccggctgcaggacgaggtcctcaaacgcgagtggggtttcgacggggtggtcgtc
tccgactggcgggccgcccgggacacggtcggcgccgcgctcggcggcctcgacatcgcc
atgccggcgatggacaacccctgggggccgcggctcgcggcggcggtccggtccgggcag
gtgccggtcgaggtcgtcgatgacaaggtacgtcgtctcctccggctcgccgcgcgcgtc
ggcgccctgggtgcgccaccggtggtgacggccgcggcggtggacggcggcgaggtggcc
caccgggtggccgcccgctccttcgtgctgacccgcaaccggggcgtgctgccgctgccc
ccggagcggaccggcgggatcgcggtgatcggcgcgctcgcccaggacgcccgggtgctc
ggcggcggcagcgcccaggtcgccccgccgcacgtgatctcgccgctggacgggatccgc
cgggtgttcggcgacgtcgcctacgcggtcggcgccgacccgcgcccgttcctgccggcc
gcgcagggccccggctggtcggcgttcaccatcgacctgggggcgtaccgcttcgaggtg
cccaccgccgcggtccgctggctcggcgacccacccggcgggctcgccgtgccggacgtc
acgacgctcgaactgaccaccacgtacaccccggaaatcggcggtgagcacgtcttcgcg
gtctccggcttcggcacgttccagctgaccgtcggcggtcaggagctctaccggggatcg
ctgcacccgcccggcaccggccgcgccgacctgctcctgcacccgcgcgaacagcgcttt
ccggtgcgcctagccgccggcgaaccggtccggctgaccctgcggcaaagcttcgcacca
gggacggcgcactcggccggcaccaccctcgggcaccgcccgcccggcccggacgcggac
ggcctgatcgccgaagcggtcgatctggcccgccactgcgacgtggcggtcgtcgtggtc
ggcaccaccgagcaggtcgaatcggaaggcttcgaccgcacctcgctggccctgcccggc
cggcaggacgaactggtcgcccgggtcgcggcggccaacccgtccacggtcgtggtggtc
aacgccggcgcgccggtgctgctgccctgggccgacgaggtggccgcggtgctgctcacc
tggttccccgggcaggaggcgggcgccgcgctcgcggcggtgctgagcggcgccgaggaa
cccggcgggcgactgccgaccacctggccgcggcacgagacggactgcccggtgctgacg
gtgcagccccgggacggggtggtgacgtacgacgaagggatcttcatcggctatcgcggg
tggcgggccgcaccgttgtacgccttcggatccgggtccggatacacgacctgggagtac
tccgggctgacggcgaccgcgaccgaggtggcggtgacagtgaccaacagcgggcagcgg
gccgggcgggaggtcgtgcagatctacctgtccgcgcgggacgacggggcggtcgaacgg
ccggagcggtggctggccgggttcgcgtcggtcacggccgacgccggggagcgggtcacg
gtgcggattccgctgccggagcgggccttccaggtctggacggacgggtggcggacgctg
cccgggcgttacacggtcatcgcggcgcacgctctggacgatccccggctgaccgccgag
atcgagaaaccgcaggcttga

DBGET integrated database retrieval system