KEGG   Actinoplanes sp. SE50/110: ACPL_2090Help
Entry
ACPL_2090         CDS       T02044                                 

Gene name
pit
Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ase  Actinoplanes sp. SE50/110
Brite
KEGG Orthology (KO) [BR:ase00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ACPL_2090 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEV82987
UniProt: G8SHD8
Position
complement(2232222..2233442)
Genome map
AA seq 406 aa AA seqDB search
MTQTTVVLILVVITALGFDFTNGFHDTANAMATSIATGALRPRVAVLLSAVLNLVGAFLS
VQVALTVTNAVVRIQNSDGTPKADLLADGGQALLLIVLAGLVGGIVWNLLTWLLGLPSSS
SHALFGGLIGAAVAGLGWSGVKWTGDGTKLDGVLGKVILPAIMSPVIAGAVAAVGTWIIY
RITVGVAQRFTENGFRWGQIGSASLVSLAHGTNDAQKTMGVITLALIASGEWTDTGNIPL
WVKVACALAIALGTYLGGWRVIRTLGKGLVEITSPQGMAAETASAAVILSSSHLGFALST
THVATGSILGSGVGKPGARVRWAVAGRMVAAWSITLPAAALVGAVMWWLGDLVGGLGGAL
LIFAVLVALSVFMYLRSRREPVDQHNVNDEWDTPAARPRETAGAAS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagacaaccgtggtcctcatcctcgtggtcatcaccgccctcggattcgacttc
accaacggcttccacgacacggccaacgcgatggcgacctcgatcgccaccggcgcgctg
cgtcccagggtggctgtgctcctgtccgccgtgctcaacctggtcggcgcgttcctctcg
gtgcaggtcgcgctcaccgtcaccaacgcggtggtcagaatccagaacagcgacggcacc
ccgaaggcggatctgctcgccgacggcggccaggccctgctgctgatcgtgctggccggc
ctggtcggcggcatcgtgtggaatctgctgacctggctgctcggcctgccgtccagctcg
tcgcacgcgctcttcggcggcctgatcggcgccgcggtggccggcctcggctggagcggg
gtcaagtggaccggcgacggcaccaaactggacggcgtgctcggcaaggtgatcctgccg
gcgatcatgtccccggtgatcgccggtgcggtcgccgcggtgggcacctggatcatctac
cggatcaccgtcggggtggcgcagcgcttcaccgagaacggcttccgctggggccagatc
ggttcggcctcactggtctcgctcgcgcacggcaccaacgacgcgcagaagacgatgggg
gtcatcacgctcgccctgatcgcctccggcgagtggaccgacaccgggaacatcccgctc
tgggtcaaggtcgcgtgtgcgctggccatcgccctcggcacctacctgggcggctggcgg
gtcatccggaccctcggcaaggggctggtcgagatcacctcgccgcagggcatggcggcc
gagaccgcctcggccgcggtgatcctctcctccagccatctcgggttcgcgctgtccacc
acgcacgtggcgaccggctcgatcctgggctccggggtcggcaagccgggcgcgcgggtg
cgctgggcggtggccggccggatggtggccgcctggtcgatcacgctgcccgcggcggcc
ctggtcggcgcggtcatgtggtggctcggcgacctggtcggcggcctcggcggcgcgctg
ctgatcttcgcggtcctggtcgcactctccgtgttcatgtatctccggtcgcgccgcgaa
ccggtcgaccagcacaacgtcaacgacgagtgggacaccccggccgcccggccgcgggag
accgccggcgcggcgagctga

DBGET integrated database retrieval system